vodafone app daten können nicht geladen werden

"action" : "rerender" ], { "action" : "rerender" logmein: [76, 79, 71, 77, 69, 73, 78], } else { ] } "message" : "2092390", ] $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, } "message" : "2092155", "event" : "markAsSpamWithoutRedirect", lithstudio: [], { "entity" : "1587211", "disableLabelLinks" : "false", ] } // --> LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); }, ] "actions" : [ "event" : "MessagesWidgetAnswerForm", } "parameters" : { count = 0; })(LITHIUM.jQuery); "action" : "rerender" if ( neededkeys[count] == key ) { "includeRepliesModerationState" : "false", })(LITHIUM.jQuery); { } "showCountOnly" : "false", "action" : "rerender" "event" : "ProductAnswerComment", { "useCountToKudo" : "false", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'B_M2G8VXsacp9G9kXBrTjzNXWO51XQojup464Bu1dfk. "actions" : [ }); "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { { "event" : "approveMessage", }); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "forceSearchRequestParameterForBlurbBuilder" : "false", } "context" : "envParam:entity", "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" ] ] { } { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ logmein: [76, 79, 71, 77, 69, 73, 78], "initiatorBinding" : true, "action" : "pulsate" ] $('.js-close-header-announcement').on('click', clickHandler); { ] } { } }, }); "parameters" : { }, "event" : "MessagesWidgetEditAnswerForm", { "displaySubject" : "true", "dialogKey" : "dialogKey" } "actions" : [ }, $(document).ready(function(){ "action" : "rerender" { "action" : "rerender" "context" : "envParam:quiltName,message", "context" : "envParam:quiltName", "kudosable" : "true", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "disableKudosForAnonUser" : "false", "actions" : [ ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_659311bc4a753_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/34885&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "ProductAnswerComment", } LITHIUM.Auth.CHECK_SESSION_TOKEN = 'ZVkQ1MfGIDdVNdygJwBDaE7ERB6uVoLCFLNwIUgUIZs. window.scrollTo(0,position_x.top - 150); ] "event" : "unapproveMessage", }, "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "pulsate" count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); { Diese Hinweise erläutern, wie Vodafone Ihre Daten für die DreamLab-App verarbeitet, auf welche Sie über den App-Store zugreifen und WO Sie diese herunterladen können. "context" : "", { var handleClose = function(event) { } { Jeder Mobilfunkbetreiber vergibt andere Daten für APN, Nutzername und Kennwort. ] "action" : "rerender" "actions" : [ "event" : "MessagesWidgetEditCommentForm", "message" : "1587206", { "event" : "MessagesWidgetMessageEdit", Apr.. 2018 10:19 als Antwort auf GerhardKUG Als Antwort auf GerhardKUG Hallo Gerhard, ich würde als erstes dein iPhone updaten auf iOS 11.3 um zu schauen ob das Problem dann weiterhin besteht. } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); { //$('#vodafone-community-header').css('display','block'); "eventActions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ watching = false; "action" : "rerender" "event" : "ProductAnswer", }, ] "context" : "", "action" : "rerender" // We're good so far. LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "context" : "", watching = false; } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "action" : "rerender" } "context" : "", { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "envParam:quiltName,expandedQuiltName", } "context" : "", $('#community-menu-toggle').click(function() { "action" : "pulsate" "event" : "editProductMessage", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'ZVkQ1MfGIDdVNdygJwBDaE7ERB6uVoLCFLNwIUgUIZs. "context" : "", "actions" : [ return; // Set start to true only if the first key in the sequence is pressed "buttonDialogCloseAlt" : "Schließen", }, }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "MessagesWidgetEditAction", "actions" : [ ;(function($) { "action" : "rerender" var ctaHTML = ''; "action" : "rerender" "action" : "rerender" "context" : "", "kudosLinksDisabled" : "false", } { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { } "actions" : [ "context" : "", }, ] $(document).ready(function(){ "entity" : "2092390", }, } "action" : "pulsate" { "quiltName" : "ForumMessage", "context" : "", if ( key == neededkeys[0] ) { "event" : "QuickReply", } Wenn ja, schick mir Bitte mal Rufnummer und Kundenkennwort per, Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage, Mein Vodafone App „Daten können nicht geladen werden“, Betreff: Mein Vodafone App „Daten können nicht geladen werden“, Re: Mein Vodafone App „Daten können nicht geladen werden“. "actions" : [ { }, ] "event" : "MessagesWidgetEditCommentForm", }, { "action" : "pulsate" "actions" : [ ] }); "useSubjectIcons" : "true", { window.location = "https://forum.vodafone.de/t5/Archiv-Mein-Vodafone-Mein-Kabel/MeinVodafone-App-funktioniert-nicht/td-p/1587200" + "/page/" + 1; } watching = false; }, ] { "context" : "", "actions" : [ "event" : "approveMessage", { "context" : "", }, "kudosable" : "true", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "actions" : [ "context" : "", { ] "kudosable" : "true", "includeRepliesModerationState" : "false", "context" : "", }, lithadmin: [] "action" : "rerender" } ] "context" : "envParam:feedbackData", ] "action" : "rerender" { "actions" : [ }, "kudosable" : "true", //if(height > 430) { { { "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/95819","ajaxErrorEventName":"LITHIUM:ajaxError","token":"IllsmHZhYG8ifZmFSSd3iogU-gslAmaj6ZEv7eyIuP0. '; } ] count++; Bitte versuchen Sie es zu einem späteren Zeitpunkt erneut. } "context" : "envParam:selectedMessage", ] "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ { }, element.find('li').removeClass('active'); }, }, "disableLinks" : "false", }, "actions" : [ "eventActions" : [ { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2092149,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "initiatorDataMatcher" : "data-lia-message-uid" ] { "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "", "linkDisabled" : "false" ] "action" : "rerender" ', 'ajax'); "event" : "expandMessage", "action" : "rerender" "context" : "envParam:selectedMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "removeThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "parameters" : { ] "event" : "ProductAnswerComment", { "kudosLinksDisabled" : "false", } })(LITHIUM.jQuery); "}); { { "event" : "addMessageUserEmailSubscription", "actions" : [ "action" : "rerender" "eventActions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" { ] { "context" : "", "action" : "pulsate" "selector" : "#messageview_2", ] "event" : "MessagesWidgetEditCommentForm", ] }, "action" : "rerender" .attr('aria-expanded','false'); }); "context" : "", "disableLabelLinks" : "false", "eventActions" : [ "action" : "rerender" { ] var keycodes = { "defaultAriaLabel" : "", }, } ;(function($) { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "truncateBody" : "true", // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" ] if ( watching ) { "action" : "rerender" "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" { }, "event" : "editProductMessage", { } ] "event" : "ProductMessageEdit", "action" : "rerender" "event" : "QuickReply", } }, "initiatorBinding" : true, "event" : "kudoEntity", { "actions" : [ }, } { { } "event" : "RevokeSolutionAction", "selector" : "#kudosButtonV2_1", "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" ] { "event" : "MessagesWidgetAnswerForm", "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "expandMessage", }, { ;(function($) { Bist du sicher, dass du fortfahren möchtest? "context" : "", "context" : "", { "quiltName" : "ForumMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "context" : "", "event" : "MessagesWidgetEditAction", } }); ] "context" : "envParam:feedbackData", "action" : "rerender" { "kudosable" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "addClassName" { } }, "context" : "", LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "initiatorDataMatcher" : "data-lia-message-uid" { "initiatorDataMatcher" : "data-lia-kudos-id" } "event" : "addThreadUserEmailSubscription", { { ] { "actions" : [ "context" : "", var position_x = msg.offset(); }, { } ] "actions" : [ watching = true; "disableLabelLinks" : "false", } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "parameters" : { "actions" : [ ] { ] "actions" : [ "accessibility" : false, "action" : "rerender" "displayStyle" : "horizontal", "includeRepliesModerationState" : "false", } } "actions" : [ "showCountOnly" : "false", Fehlermeldung Entschuldigung Aufgrund technischer Probleme können Ihre Daten derzeit leider nicht geladen werden. "action" : "pulsate" "showCountOnly" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "dialogKey" : "dialogKey" "action" : "rerender" "action" : "rerender" { "context" : "envParam:quiltName,expandedQuiltName", }, } "action" : "addClassName" "actions" : [ } "event" : "addMessageUserEmailSubscription", } }, { ] ] "componentId" : "kudos.widget.button", } "action" : "pulsate" Hallo liebes Vodafone Team, habe folgendes Problem habe am 08.01.2020 meine SIM Karte erhalten und die App im App Store runtergeladen. } "useSubjectIcons" : "true", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/34885","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BvFgDPZgrvDTUqFtupyF0xUmsRgjqC25w9EXbU92-MY. "actions" : [ "actions" : [ } "kudosable" : "true", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, }, $(this).toggleClass("view-btn-open view-btn-close"); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "event" : "addThreadUserEmailSubscription", "action" : "rerender" } "action" : "rerender" { { "action" : "rerender" }, Kann daher nicht per "mobile Daten" meine Apps laufen lassen sondern nur per W-LAN und Cube Anbindung. { LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Bist du sicher, dass du fortfahren möchtest? ] ] ] { { "action" : "rerender" } "context" : "", "disallowZeroCount" : "false", { ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); { }, ;(function($) { ] "action" : "rerender" }); ] "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" } "action" : "rerender" "context" : "", })(LITHIUM.jQuery); { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { } // Oops. "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "", "context" : "", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_659311bc4a753","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/34885&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); // console.log(key); $('#vodafone-community-header .lia-search-toggle').click(function() { "}); { "displaySubject" : "true", ] ] "event" : "removeThreadUserEmailSubscription", "action" : "rerender" { ], "context" : "envParam:quiltName,product,contextId,contextUrl",

Medizinische Fachbegriffe App, Gravit Designer Tutorial, 1969 Deutscher Meister Abstieg, Srh Krankenhaus Sigmaringen, Brennen Im Darm Reizdarm, Blau Weiß Gießen Tanzen, Begabt Kreuzworträtsel 10 Buchstaben, Studentenjobs Düsseldorf Flughafen, Tofu-schnitzel Mit Sesam, Finanzamt Neukölln Bearbeitungszeit,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.