vodafone business dual stack

"action" : "pulsate" "selector" : "#messageview_6", { ], "event" : "RevokeSolutionAction", ] ] { { ] { } "initiatorBinding" : true, }, ] { "context" : "", }, "context" : "lia-deleted-state", } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2066635 .lia-rating-control-passive', '#form_5'); // console.log(key); ] } "displaySubject" : "true", "context" : "", { { { }, }, "initiatorBinding" : true, } } "context" : "", ', 'ajax'); }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] { } "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "MessagesWidgetEditAction", { } "actions" : [ } } "event" : "kudoEntity", "event" : "MessagesWidgetEditAction", } "context" : "", "displayStyle" : "horizontal", ] { }, { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", { "quiltName" : "ForumMessage", }, "activecastFullscreen" : false, "action" : "rerender" "linkDisabled" : "false" }); "action" : "rerender" "action" : "rerender" "action" : "rerender" "context" : "", $(document).ready(function(){ "actions" : [ // We made it! } { "kudosLinksDisabled" : "false", var key = e.keyCode; ] ] ] "action" : "pulsate" Negru. ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2067099,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "eventActions" : [ { ', 'ajax'); { "disableKudosForAnonUser" : "false", } }, Dual Stack Dual stack is a network where both IPv4 and IPv6 addresses are enabled. "context" : "", } } "context" : "", }, "messageViewOptions" : "1111110111111111111110111110100101001101" { "event" : "MessagesWidgetCommentForm", "}); { "context" : "envParam:quiltName", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "context" : "envParam:quiltName,message", { ] ] ] "context" : "envParam:feedbackData", "context" : "", }, "event" : "MessagesWidgetEditAnswerForm", { } ] } { "action" : "rerender" { } { } "action" : "rerender" "kudosable" : "true", ] ] "event" : "RevokeSolutionAction", Bist du sicher, dass du fortfahren möchtest? } "}); }, } }); { "actions" : [ } }, "event" : "ProductMessageEdit", "linkDisabled" : "false" ] ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:entity", { { } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); ;(function($) { }, } }, $(this).next().toggle(); LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'iwuPrICeQDu8FKFv7_4Qa1Mhf7M6oot4N13G9yAo84A. "actions" : [ { "context" : "", "actions" : [ "displaySubject" : "true", { LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); } "event" : "MessagesWidgetEditAnswerForm", "event" : "MessagesWidgetAnswerForm", { } "action" : "rerender" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Ic4bPvHUwEPZ1Y1qE_b-ZJJiWQ-AczJWzuKQ0UU10aA. "actions" : [ ] "actions" : [ }, "parameters" : { Por isso, se está a fazer o seu negócio começar, mudar ou crescer, faça-o com a melhor rede, faça-o com a Vodafone Business. ] var watching = false; }, }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "includeRepliesModerationState" : "false", "event" : "removeThreadUserEmailSubscription", ] } { }, }, ] "componentId" : "forums.widget.message-view", ] "context" : "", ] { var key = e.keyCode; "quiltName" : "ForumMessage", "action" : "rerender" "disableLabelLinks" : "false", { { "actions" : [ "actions" : [ "context" : "", "action" : "pulsate" })(LITHIUM.jQuery); "actions" : [ "kudosLinksDisabled" : "false", { "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ ] } "event" : "removeThreadUserEmailSubscription", { "event" : "MessagesWidgetEditCommentForm", "displaySubject" : "true", "message" : "2066632", "parameters" : { ;(function($) { "event" : "MessagesWidgetCommentForm", } "context" : "", } { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, } "context" : "", } } { { } "event" : "MessagesWidgetAnswerForm", } "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"EYTzEio1aqoiHXjgHSmhDr1cUGSaQ5e9lOY-XWxApGk. } "context" : "envParam:quiltName,message", ] Execute whatever should happen when entering the right sequence "action" : "rerender" "action" : "pulsate" "context" : "envParam:selectedMessage", }, ] } }, ] { "showCountOnly" : "false", }, "context" : "", }, "actions" : [ "revokeMode" : "true", "actions" : [ } "truncateBody" : "true", "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "includeRepliesModerationState" : "false", { { }, // --> A kosár tartalma az alábbi gombokra kattintva tekinthető meg . "context" : "", "eventActions" : [ } "event" : "MessagesWidgetCommentForm", { { } ] "selector" : "#messageview_7", "action" : "rerender" { ] { "initiatorDataMatcher" : "data-lia-message-uid" } "actions" : [ "truncateBodyRetainsHtml" : "false", "defaultAriaLabel" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "removeMessageUserEmailSubscription", $(this).next().toggle(); "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "actions" : [ "actions" : [ "context" : "", { { { { "actions" : [ "actions" : [ { "context" : "", }, "}); "action" : "rerender" } "event" : "ProductAnswerComment", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "addMessageUserEmailSubscription", "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "event" : "MessagesWidgetEditAction", "action" : "rerender" "context" : "", count = 0; { "context" : "", }, "event" : "removeThreadUserEmailSubscription", "quiltName" : "ForumMessage", ] ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "action" : "pulsate" "entity" : "2067421", { "actions" : [ ] { "action" : "pulsate" "parameters" : { "event" : "unapproveMessage", { "action" : "rerender" ;(function($) { "action" : "rerender" { "context" : "envParam:quiltName,product,contextId,contextUrl", Easily manage your company's mobile or fixed line accounts online 24/7. } ] { ] LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "action" : "rerender" "actions" : [ }, "event" : "AcceptSolutionAction", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { }, "event" : "ProductAnswerComment", "context" : "envParam:quiltName,product,contextId,contextUrl", } }, }, }, { { "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { { "action" : "pulsate" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"swTKvpn0YZ0zOGGSG-Qi8cad_NoumBkSCTTwBz7hQwM. "eventActions" : [ }, } "event" : "RevokeSolutionAction", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" We are the world's largest IoT service provider and mobile voice provider. LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } } { "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "actions" : [ } "kudosLinksDisabled" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "", ] ] "actions" : [ } "initiatorBinding" : true, "context" : "", // Oops, not the right sequence, lets restart from the top. "initiatorBinding" : true, // Set start to true only if the first key in the sequence is pressed "disableLinks" : "false", "actions" : [ { }, "eventActions" : [ "event" : "addThreadUserEmailSubscription", } "actions" : [ ] ] "context" : "envParam:entity", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2065620,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { "action" : "pulsate" } "componentId" : "kudos.widget.button", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ Vodafone Business Plans. "context" : "", "context" : "", "componentId" : "kudos.widget.button", { //var height = $(window).scrollTop(); } "actions" : [ "actions" : [ "action" : "rerender" } { ] } "action" : "rerender" "eventActions" : [ { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "action" : "rerender" } "action" : "rerender" { }, { { { "useSubjectIcons" : "true", "quiltName" : "ForumMessage", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233128}); "linkDisabled" : "false" LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disableLabelLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "}); "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "AcceptSolutionAction", "useSimpleView" : "false", { $(document).ready(function(){ "action" : "rerender" ;(function($) { }, }, { } "useSubjectIcons" : "true", "initiatorBinding" : true, "event" : "addThreadUserEmailSubscription", "disableKudosForAnonUser" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" } "action" : "rerender" "initiatorBinding" : true, })(LITHIUM.jQuery); ] "event" : "MessagesWidgetEditAnswerForm", "parameters" : { "dialogKey" : "dialogKey" ], }, { "event" : "kudoEntity", "action" : "rerender" "eventActions" : [ "event" : "ProductAnswer", "action" : "rerender" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); } "context" : "", "event" : "expandMessage", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", { "context" : "", //if(height > 430) { "disableLabelLinks" : "false", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { ', 'ajax'); LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { ] "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Bist du sicher, dass du fortfahren möchtest? $('.lia-button-wrapper-searchForm-action').removeClass('active'); ', 'ajax'); { "disallowZeroCount" : "false", "context" : "", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "initiatorBinding" : true, } "event" : "MessagesWidgetEditCommentForm", "event" : "MessagesWidgetEditAction", "actions" : [ { "useSubjectIcons" : "true", }); "context" : "envParam:feedbackData", }, "initiatorBinding" : true, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "accessibility" : false, "event" : "AcceptSolutionAction", "revokeMode" : "true", ;(function($) { "action" : "pulsate" "actions" : [ } { "event" : "RevokeSolutionAction", "action" : "rerender"

Fra Diavolo Weinkeller, Wanderung Erlenbach Stockhorn, Modetrends Frühjahr/sommer 2021 Herren, Appartello Hamburg Frühstück, Selbstständigkeit Schweiz Ausländer,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.