vodafone kündigungsfrist verpasst

LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/235604","ajaxErrorEventName":"LITHIUM:ajaxError","token":"xlblTCVG7CRr_fg75zB8QRpZPaX7sfj0FW7kRYJsK4g. }, LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ ] "context" : "", }, "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" { }, { "action" : "rerender" "}); }, }); "disableLinks" : "false", "action" : "rerender" if ( !watching ) { "eventActions" : [ { ] "event" : "deleteMessage", ] ] } }, "event" : "unapproveMessage", ] Bist du sicher, dass du fortfahren möchtest? "event" : "removeThreadUserEmailSubscription", "initiatorDataMatcher" : "data-lia-kudos-id" "quiltName" : "ForumMessage", } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233474}); }, { }, "actions" : [ "action" : "rerender" $('#node-menu li.has-sub>a').on('click', function(){ "disableLabelLinks" : "false", "context" : "", "action" : "rerender" "actions" : [ "actions" : [ "event" : "kudoEntity", "action" : "rerender" }, }, "action" : "rerender" "kudosLinksDisabled" : "false", } ] "componentId" : "kudos.widget.button", "event" : "expandMessage", $('.lia-autocomplete-footer').append(ctaHTML); "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/235604","ajaxErrorEventName":"LITHIUM:ajaxError","token":"grAhopLrHunIPc8FiZgomVzBeV0Lo-82xW28LXYYZe8. "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", "event" : "MessagesWidgetEditAction", ] "action" : "rerender" { "action" : "rerender" "event" : "kudoEntity", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2177973,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", }, }, { LITHIUM.AjaxSupport.ComponentEvents.set({ { "displaySubject" : "true", { $(document).ready(function(){ logmein: [76, 79, 71, 77, 69, 73, 78], "action" : "rerender" { "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "parameters" : { { }, "kudosLinksDisabled" : "false", }, { ;(function($) { "context" : "", "actions" : [ { } "actions" : [ "action" : "rerender" }, window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1605,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk16C1daWFQQWA1lHSlHdFcQcXdcAV8BTFwFEVEWXEBAHxNTFElTERFDOBpHUB8VakkLA1VUD1EGERgQA0QHVFcrBhVeBAEABFwGVAsKUVsDSBdYV2cWUxRwVkBYGlUZEV9RNVcBXHwDD1JGDxFyXRdDC21dEgtUNFRUURBJFA1afw0AXghQEQ4QA1cKSldAThUPVnFbRkcMRF9TDhFSRhkRX1ExTkQDEANVAlFTBgQFSAZSDgNPVgRVBB5WBAAGS1xWW1oEVAMEBVAAUkQVEAkBeQtRVn1WRwxECwJSUxVIF1hXYABFEm8AMxdSFkwRDhA2cyp8cTZCXgAVdWZ9KBYLXEERA1ABRhNjeiBkIxlGDRJeBxtaUA9aFipwfys2F1sXTkk="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", ] }); "context" : "", }, "actions" : [ { "context" : "", ] { ] "event" : "deleteMessage", ], }); } ] } "action" : "rerender" } LITHIUM.AjaxSupport.ComponentEvents.set({ "parameters" : { }, "useTruncatedSubject" : "true", "actions" : [ } { { { { "event" : "MessagesWidgetCommentForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ }, "actions" : [ watching = false; ] } "disableLabelLinks" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:feedbackData", "actions" : [ "message" : "2177021", } "event" : "ProductMessageEdit", ] ] "event" : "MessagesWidgetEditAction", }, } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2178066,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } { "showCountOnly" : "false", { }, } }, ;(function($) { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2178066,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. // We made it! "initiatorBinding" : true, ;(function($) { "context" : "envParam:feedbackData", { "action" : "rerender" }, } "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "actions" : [ }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); count = 0; KundeXYZ. "action" : "pulsate" "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "initiatorBinding" : true, ] "event" : "approveMessage", "action" : "rerender" "action" : "rerender" { "actions" : [ "displayStyle" : "horizontal", "disableLabelLinks" : "false", ] ] "event" : "QuickReply", { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "selector" : "#kudosButtonV2_7", "action" : "rerender" }, { Die Kündigungsfrist für DSL-Verträge von Vodafone beträgt immer, unabhängig von gebuchten Tarif, drei Monate zum Ende der aktuellen Laufzeit. "action" : "rerender" "quiltName" : "ForumMessage", ] "parameters" : { { "entity" : "2178066", }); Unter Berücksichtigung der Lizenzvereinbarungen dürfen Sie das Dokument verwenden, verändern und kopieren, wenn Sie dabei Recht-Finanzen deutlich als Urheber … "event" : "removeMessageUserEmailSubscription", "context" : "", "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ } $(document).ready(function(){ "disableKudosForAnonUser" : "false", "}); "actions" : [ "event" : "editProductMessage", }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { }); "action" : "rerender" "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); Hallo zusammen, ich wollte meinen Vodafone DSL Vertrag kündigen. "context" : "envParam:selectedMessage", var watching = false; ] { "event" : "markAsSpamWithoutRedirect", }, }, ] } { "eventActions" : [ "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "context" : "", "actions" : [ "context" : "", "disableLabelLinks" : "false", }, // Reset the conditions so that someone can do it all again. "parameters" : { LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); } } { }, "selector" : "#messageview_7", { "action" : "rerender" } { }, "event" : "addThreadUserEmailSubscription", "useCountToKudo" : "false", { "actions" : [ } "disableKudosForAnonUser" : "false", "componentId" : "kudos.widget.button", .attr('aria-expanded','false'); { "includeRepliesModerationState" : "false", "actions" : [ "action" : "rerender" } "disallowZeroCount" : "false", "context" : "envParam:entity", } ] "actions" : [ { { // just for convenience, you need a login anyways... "event" : "removeMessageUserEmailSubscription", ctaHTML += "Lösung noch nicht gefunden? "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2177987,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { ] "actions" : [ "displayStyle" : "horizontal", } { { "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "event" : "RevokeSolutionAction", } Identitätsdiebstahl. "defaultAriaLabel" : "", "action" : "rerender" "action" : "rerender" { } "includeRepliesModerationState" : "false", "context" : "", "action" : "rerender" "event" : "ProductAnswer", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { // Oops, not the right sequence, lets restart from the top. "action" : "addClassName" { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); In Ausnahmefällen können Sie mit einer außerordentlichen Kündigung Ihren Vertrag früher beenden. LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { { { "action" : "rerender" ] } "context" : "lia-deleted-state", }, "actions" : [ }, "actions" : [ ] { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "displayStyle" : "horizontal", }, "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" "includeRepliesModerationState" : "false", "event" : "editProductMessage", "action" : "rerender" { "context" : "", "disableLinks" : "false", "componentId" : "kudos.widget.button", "event" : "MessagesWidgetEditAction", "useSimpleView" : "false", "event" : "ProductMessageEdit", ] "action" : "rerender" "action" : "rerender" Es reicht nicht aus, dieses 3 Monate vorher zur Post zu bringen. } { } "context" : "", }, ], Ohne fristgerechte Kündigung wird das Vertragsverhältnis um zwölf weitere Monate verlängert. }, } { ] { $(document).ready(function(){ ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "actions" : [ } "initiatorBinding" : true, "action" : "pulsate" "componentId" : "kudos.widget.button", "actions" : [ "quiltName" : "ForumMessage", { ;(function($) { "actions" : [ ] { } "actions" : [ }, "action" : "rerender" }); { "actions" : [ Da auch der Abschluss eines Prepaid-Tarifs einem Vertrag gemäß dem Bürgerlichen Gesetzbuch entspricht, musst du auch dieses Vertragsverhältnis ordentlich kündigen. }, "eventActions" : [ "context" : "", { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; Re: Telefonische Vertragsverlängerung - besprochen... Betreff: Retoure abgelehnt wegen Gebrauchtspuren. }, "truncateBodyRetainsHtml" : "false", "actions" : [ LITHIUM.Dialog({ } "event" : "approveMessage", "action" : "rerender" "actions" : [ "activecastFullscreen" : false, ] LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "actions" : [ "truncateBody" : "true", { ] "disallowZeroCount" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "event" : "ProductMessageEdit", "context" : "", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2177689,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. // We made it! }, ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'gFQJkJKR6Ww4xBFsAfWna1M1zkejqiNSREtrbvw7pX4. { ] { "actions" : [ "action" : "pulsate" "action" : "rerender" } } "action" : "rerender" { "action" : "pulsate" "event" : "AcceptSolutionAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" } "event" : "QuickReply", "messageViewOptions" : "1111110111111111111110111110100101001101"

Excel Vba Pivot Filter Mehrere Kriterien, Jura Vorlesung Online, Kompliment Mit Y, Livedo Reticularis Behandlung, Durch Wirbelsäule Magenschmerzen,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.