vodafone kabel ipv4 beantragen

"context" : "envParam:quiltName", "action" : "rerender" { }, { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); if ( Number(val) < 1 ) LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'ogVt3gXGthfZf9vc5zHMinAAA7Vg6B7fHlMiFx-ANdk. "actions" : [ }, "event" : "markAsSpamWithoutRedirect", "displayStyle" : "horizontal", { "action" : "pulsate" } }, { "}); logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "", "event" : "addMessageUserEmailSubscription", "action" : "rerender" "actions" : [ "kudosLinksDisabled" : "false", ] "event" : "MessagesWidgetEditAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "event" : "kudoEntity", "context" : "", "action" : "rerender" "action" : "rerender" } "context" : "envParam:quiltName,product,contextId,contextUrl", "truncateBodyRetainsHtml" : "false", }, "context" : "envParam:selectedMessage", "displaySubject" : "true", "context" : "", }); "action" : "rerender" { "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); "useCountToKudo" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'uQBuYZizsR65e103AZGjZW0OSrVIPzyQVKG8SNIk0E4. "truncateBody" : "true", "actions" : [ > 0) ) "actions" : [ ], "context" : "", "linkDisabled" : "false" "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "AcceptSolutionAction", "componentId" : "kudos.widget.button", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", // Reset the conditions so that someone can do it all again. "event" : "MessagesWidgetMessageEdit", ] } "useCountToKudo" : "false", "truncateBodyRetainsHtml" : "false", "actions" : [ ;(function($) { }, } "context" : "lia-deleted-state", "message" : "1629637", "parameters" : { { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/71169","ajaxErrorEventName":"LITHIUM:ajaxError","token":"E_T4cN64OGQqgJUjdLX6-gOMK1WLwdl4HO_rYeaSvb0. clearWarning(pagerId); ], return; "actions" : [ }, { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { { "event" : "MessagesWidgetAnswerForm", { "disallowZeroCount" : "false", "selector" : "#kudosButtonV2_5", }); "triggerEvent" : "click", { } } }, ] { }, ] "}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ "useSimpleView" : "false", "context" : "", { }, }, o.innerHTML = "Page must be an integer number. }, } "context" : "envParam:selectedMessage", { "actions" : [ }, ] "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { $('#vodafone-community-header').toggle(); LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); } "action" : "rerender" ] "parameters" : { "actions" : [ { } $(document).ready(function(){ logmein: [76, 79, 71, 77, 69, 73, 78], { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'ufNxHAR72lR2-f-7Wez6i5F0H2uf1tX1QsW37Fvk7Cw. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ } $('section.header-announcement').slideUp(); { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "event" : "ProductAnswer", { "context" : "envParam:quiltName,product,contextId,contextUrl", { "componentId" : "forums.widget.message-view", { { ] }, { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "dialogKey" : "dialogKey" { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); } }); "action" : "rerender" { }, { "action" : "rerender" }, "context" : "", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "eventActions" : [ "event" : "expandMessage", { "useSubjectIcons" : "true", "action" : "rerender" "action" : "pulsate" "actions" : [ "useSubjectIcons" : "true", "; { { { ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "context" : "envParam:feedbackData", ] ] "componentId" : "forums.widget.message-view", "actions" : [ "revokeMode" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); count++; "disableKudosForAnonUser" : "false", { } }, { "componentId" : "forums.widget.message-view", "context" : "envParam:quiltName,message", } "displaySubject" : "true", "useSimpleView" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", watching = false; ] }, if ( Number(val) > 2 ) "actions" : [ } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "showCountOnly" : "false", ] }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1629557,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" { "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "actions" : [ }, { { { } { ] "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "event" : "AcceptSolutionAction", ] "event" : "editProductMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ } }, "action" : "pulsate" } "event" : "QuickReply", } else { { "action" : "rerender" } "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "action" : "rerender" }, "action" : "rerender" "entity" : "1671441", ], { "actions" : [ "action" : "rerender" LITHIUM.Dialog.options['-1226769034'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] { }, { "action" : "rerender" "useSubjectIcons" : "true", "actions" : [ } "action" : "rerender" } { } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } "disableLinks" : "false", var count = 0; "}); } "context" : "", "actions" : [ "action" : "rerender" { "context" : "", "displayStyle" : "horizontal", { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "eventActions" : [ ] "context" : "envParam:feedbackData", ] "actions" : [ { }, "actions" : [ { { function setWarning(pagerId) { "actions" : [ "action" : "rerender" "event" : "addThreadUserEmailSubscription", }, ] "action" : "rerender" function clearWarning(pagerId) { "action" : "rerender" { } LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "selector" : "#messageview_1", }; "actions" : [ } // Oops, not the right sequence, lets restart from the top. ] "context" : "", } }, } ] }, "event" : "deleteMessage", watching = false; { }, { "context" : "", { } $(document).ready(function(){ "disableLinks" : "false", { ] { "context" : "", "context" : "envParam:feedbackData", "context" : "", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); { "messageViewOptions" : "1111110111111111111110111110100101001101" } { { { "componentId" : "kudos.widget.button", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); }, } "}); "selector" : "#kudosButtonV2_8", // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" ;(function($) { "initiatorDataMatcher" : "data-lia-kudos-id" { }, } ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); ] } } "actions" : [ "actions" : [ "event" : "ProductAnswerComment", "actions" : [ "context" : "envParam:entity", { "displayStyle" : "horizontal", Auf Anhieb wirst du auf Probleme stoßen. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); { "actions" : [ "parameters" : { } }, "useSimpleView" : "false", { }, } "actions" : [ } }, "action" : "rerender" { LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "context" : "envParam:selectedMessage", "event" : "RevokeSolutionAction", } else { } { ] "event" : "MessagesWidgetAnswerForm", }, "displaySubject" : "true", } "event" : "deleteMessage", return; "action" : "rerender" "context" : "envParam:feedbackData", "selector" : "#messageview_1", "action" : "rerender" { { "actions" : [ } "event" : "RevokeSolutionAction", { ] ] } "actions" : [ ] { }); "actions" : [ "context" : "envParam:entity", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "initiatorBinding" : true, { }, { "actions" : [ { { { LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "context" : "", $(this).toggleClass('active'); "context" : "envParam:selectedMessage", "quiltName" : "ForumMessage", "action" : "pulsate" "actions" : [ Bist du sicher, dass du fortfahren möchtest? { { { } "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "displaySubject" : "true", ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, } "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAnswerForm", "initiatorBinding" : true, "}); }, { } ] "initiatorBinding" : true, ], "action" : "rerender" "action" : "rerender" return false; }, ] ] ], }, }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/71169","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vFQac3tOt7SpVZuV2umuuu-jZp30p0GpsGpQJWvfTKc. LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" } }, var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "includeRepliesModerationState" : "false", "actions" : [ "context" : "", "kudosable" : "true", "event" : "deleteMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "kudosLinksDisabled" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "disableKudosForAnonUser" : "false", }, }, { { "actions" : [ Da Vodafone Kabel Deutschland zu großten Teilen alle IPv4 Adressen verbraucht hat, werden an Neukunden nur noch DSLite Anschlüsse vergeben. { "event" : "ProductAnswer", ] { { "context" : "", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ })(LITHIUM.jQuery); "disableKudosForAnonUser" : "false", { $('.js-close-header-announcement').on('click', clickHandler); "kudosable" : "true", { "event" : "MessagesWidgetEditAction", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", "actions" : [ { "event" : "MessagesWidgetMessageEdit", } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "RevokeSolutionAction", } } LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } } "action" : "rerender" // Set start to true only if the first key in the sequence is pressed { } "componentId" : "forums.widget.message-view", ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" ], "}); { }, { "actions" : [ "context" : "", } "action" : "rerender" "context" : "envParam:feedbackData", { lithstudio: [], ] } "linkDisabled" : "false" "eventActions" : [ "action" : "rerender" } } { { ] "revokeMode" : "true", "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "event" : "removeMessageUserEmailSubscription", "actions" : [ if ( Number(val) > 2 ) { ] "actions" : [ } "disableKudosForAnonUser" : "false", "action" : "rerender" { } ], "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); }; "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetCommentForm", "action" : "rerender" } "actions" : [ } "eventActions" : [ "actions" : [ "selector" : "#kudosButtonV2_8", //$('#community-menu-toggle').removeClass('active') "action" : "rerender" }, "action" : "rerender" } "quiltName" : "ForumMessage", "action" : "rerender" "actions" : [ }, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ] Bist du sicher, dass du fortfahren möchtest? "action" : "pulsate" ] "actions" : [ "action" : "addClassName" { { { "action" : "rerender" } "action" : "rerender" "context" : "", "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", ] "disableLabelLinks" : "false", "truncateBody" : "true", "useTruncatedSubject" : "true", }, }); "action" : "rerender" } "context" : "", }, Mutmaßungen an dieser Stelle nützen weder Dir noch anderen. "action" : "addClassName" "event" : "AcceptSolutionAction", "context" : "", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" "event" : "addThreadUserEmailSubscription", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ ] "event" : "kudoEntity", "event" : "ProductMessageEdit", watching = false; $(document).ready(function(){ { LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "kudoEntity", "event" : "addMessageUserEmailSubscription", { "context" : "", } } } "truncateBody" : "true", } LITHIUM.AjaxSupport.ComponentEvents.set({ { "truncateBody" : "true", })(LITHIUM.jQuery); "disableLinks" : "false", ] "includeRepliesModerationState" : "false", "actions" : [ { }, "initiatorBinding" : true, "actions" : [ "action" : "rerender" "entity" : "1629573", { { "context" : "envParam:entity", "event" : "unapproveMessage", "componentId" : "forums.widget.message-view", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "context" : "envParam:quiltName", { "parameters" : { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); { "context" : "envParam:quiltName", "actions" : [ }); // Oops, not the right sequence, lets restart from the top. "selector" : "#messageview_1", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { } { "event" : "MessagesWidgetAnswerForm", lithadmin: [] "event" : "RevokeSolutionAction", } "action" : "rerender" "event" : "removeMessageUserEmailSubscription", }, }, } "actions" : [ "actions" : [ if ( Number(val) < 1 ) }, { }); }, { ] }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); setWarning(pagerId); ;(function($) { "disableLabelLinks" : "false", ] LITHIUM.AjaxSupport.useTickets = false; "context" : "lia-deleted-state", "actions" : [ } } "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "action" : "pulsate" }, }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } { "kudosLinksDisabled" : "false", LITHIUM.Dialog.options['1749348950'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; > 0) ) $(this).toggleClass('active'); }, "context" : "envParam:quiltName", ] } "action" : "rerender" "event" : "addMessageUserEmailSubscription", "event" : "editProductMessage", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'MtU6YFzLJhAdmy581oYOYvNqb23ejQs_sLXVk9LjRZQ. "selector" : "#kudosButtonV2_6", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "action" : "rerender" } LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "disallowZeroCount" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'Wepc24qUGzEp4Qhh6kXVvmU8yDfI_86OEuuKoT2AkYQ. ] "disableKudosForAnonUser" : "false", "actions" : [ window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1645,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAAAlpQAFIMAxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQBQADAFUHVhRTBlUCSQELDAFIDlRdBU9TUQFRCwAGVwEFCwtAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};

Umit Webmail Login, Brauhaus Dellbrück Reservieren, Alpiner Zoologischer Garten, Kaya Yanar Wien 2020, Elisabethinen Chirurgie Team, Lidl Besteck Gold, Bergtour Online Wallberg, China Großhandel Warschau, Camping Bakkum Wlan, Business Administration Fernstudium,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.