vodafone kabel business als privatkunde

LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ } "parameters" : { { { window.location.replace('/t5/user/userloginpage'); ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } } })(LITHIUM.jQuery); { { { "action" : "rerender" "action" : "rerender" $(this).toggleClass('active'); { "initiatorBinding" : true, ', 'ajax'); "initiatorDataMatcher" : "data-lia-kudos-id" { { // Set start to true only if the first key in the sequence is pressed } "action" : "rerender" { "event" : "kudoEntity", "event" : "ProductAnswerComment", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "selector" : "#messageview_7", "messageViewOptions" : "1111110111111111111110111110100101001101" ] ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2418710 .lia-rating-control-passive', '#form_4'); "actions" : [ "actions" : [ { LITHIUM.Dialog.options['797279812'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "addMessageUserEmailSubscription", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" "action" : "rerender" { } "disableLinks" : "false", }, "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" { "dialogKey" : "dialogKey" "action" : "pulsate" { $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); ] "includeRepliesModerationState" : "false", } { if ( count == neededkeys.length ) { { "truncateBody" : "true", var key = e.keyCode; { "actions" : [ }); }, "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/209574","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Pn_tnzmTwTc6EBkJcU0b8kurOy6Y4WC-8wCKCObEpO8. { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "", "event" : "deleteMessage", { LITHIUM.Dialog.options['1501097914'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "}); "action" : "addClassName" }, "action" : "rerender" { { "action" : "rerender" function clearWarning(pagerId) { "parameters" : { ] }); { { }, document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "action" : "rerender" "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", { { count = 0; CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); LITHIUM.Dialog({ "kudosLinksDisabled" : "false", "actions" : [ LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); { "action" : "rerender" if (doChecks(pagerId, val)) } "initiatorBinding" : true, "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); ], }); ', 'ajax'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/209574","ajaxErrorEventName":"LITHIUM:ajaxError","token":"GnYN7XaVqd8zti8fQqamGaYFvX2Ee7LphT4y7ejCeOs. } } "componentId" : "forums.widget.message-view", "context" : "envParam:quiltName,expandedQuiltName", ] { LITHIUM.AjaxSupport.ComponentEvents.set({ } { ] } "event" : "removeMessageUserEmailSubscription", "; "context" : "envParam:selectedMessage", "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2418009 .lia-rating-control-passive', '#form_2'); } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ ] { "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/123456/thread-id/209574","ajaxErrorEventName":"LITHIUM:ajaxError","token":"3YjAatSBD9adfzImrHEH9zZL2RI1qdAWCskyYx7px3g. "; ] { } ] "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2418001,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "useCountToKudo" : "false", "action" : "rerender" }, "actions" : [ "event" : "ProductAnswer", }, ] ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } { "action" : "rerender" "showCountOnly" : "false", "disableLinks" : "false", "parameters" : { }); { "includeRepliesModerationState" : "false", { { }, ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "selector" : "#messageview_5", "action" : "rerender" } "action" : "rerender" "actions" : [ "action" : "rerender" "actions" : [ ] { { "action" : "rerender" "useTruncatedSubject" : "true", count = 0; if ( !watching ) { "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/123456/thread-id/224462","ajaxErrorEventName":"LITHIUM:ajaxError","token":"A35y0OgPb6IGaS10po0ZRnyEzs_ckkr7MWn5lrzhcNA. "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "displayStyle" : "horizontal", "action" : "rerender" "selector" : "#kudosButtonV2_3", }, "disableLinks" : "false", "eventActions" : [ "truncateBodyRetainsHtml" : "false", "action" : "rerender" { { }, ] "context" : "envParam:quiltName", { "useCountToKudo" : "false", "action" : "pulsate" } "includeRepliesModerationState" : "false", "action" : "rerender" ] } "action" : "pulsate" { { "actions" : [ "displaySubject" : "true", ] "actions" : [ }, "useTruncatedSubject" : "true", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/209574","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Pn_tnzmTwTc6EBkJcU0b8kurOy6Y4WC-8wCKCObEpO8. ] Bist du sicher, dass du fortfahren möchtest? ] "action" : "rerender" } } "quiltName" : "ForumMessage", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"});

Myfritz Adresse Herausfinden, Prüfungsvorbereitung Kauffrau Im Gesundheitswesen Pdf, Deutsche Bahn Personalgewinnung, Pflege-examen Kompakt Pdf, Kur Trauerbewältigung Aok, Fränkische Schweiz Attraktionen, Pokemon Card Value Mavin, Klassenarbeit Englisch Klasse 8 Green Line,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.