apple watch mobilfunktarif kann nicht konfiguriert werden vodafone

"actions" : [ Das Netzbetreiber Profil lautet o2 … }, LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); } } "context" : "envParam:feedbackData", "action" : "rerender" "action" : "rerender" "actions" : [ }); } "action" : "rerender" "action" : "rerender" } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "accessibility" : false, "quiltName" : "ForumMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" "buttonDialogCloseAlt" : "Schließen", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } }); } { { { ', 'ajax'); "event" : "ProductMessageEdit", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "linkDisabled" : "false" "event" : "ProductAnswerComment", "action" : "rerender" "actions" : [ "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", } { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_70cd8b5d252d2b', 'disableAutoComplete', '#ajaxfeedback_70cd8b5b322dd8_0', 'LITHIUM:ajaxError', {}, 'KA-bzsjiIaTRkjl6wtNx33vv-KPICC9VVVHBHtWV_40. { "}); "disableLabelLinks" : "false", "context" : "", } "showCountOnly" : "false", "actions" : [ "action" : "pulsate" { { "event" : "RevokeSolutionAction", "initiatorDataMatcher" : "data-lia-message-uid" ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" element.siblings('li').find('ul').slideUp(); ] ] //}); "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); //} else { "actions" : [ }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2211093,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); Was kann ich tun ? ] "event" : "MessagesWidgetEditCommentForm", ;(function($) { "context" : "envParam:quiltName,expandedQuiltName", Ein defektes Gerät kann im Garantiefall noch von Apple ersetzt werden. { { "defaultAriaLabel" : "", Mehr $(document).ready(function(){ Entweder mit iOS 13.5.1, watchOS 6.2.6 oder einem stillen Netzbetreiber-Update hat Apple eine für Besitzer der Apple Watch teils ärgerliche Änderung implementiert. "actions" : [ $('li.close-on-click').on('click',resetMenu); "context" : "", "context" : "envParam:feedbackData", LITHIUM.AjaxSupport.ComponentEvents.set({ "parameters" : { }, "actions" : [ "event" : "AcceptSolutionAction", "disableLinks" : "false", "event" : "MessagesWidgetEditAnswerForm", "useSimpleView" : "false", { "event" : "unapproveMessage", "action" : "rerender" "event" : "addMessageUserEmailSubscription", } } { "useSimpleView" : "false", "actions" : [ Letzter Beitrag von Jp444 16.12.2020, 13:07 Apple watch … "componentId" : "kudos.widget.button", LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } }, "event" : "ProductAnswer", "kudosLinksDisabled" : "false", } "context" : "", "context" : "envParam:quiltName", "action" : "pulsate" "event" : "MessagesWidgetCommentForm", } ], ] "dialogKey" : "dialogKey" } "event" : "approveMessage", var keycodes = { "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_70cd8b5b322dd8', 'enableAutoComplete', '#ajaxfeedback_70cd8b5b322dd8_0', 'LITHIUM:ajaxError', {}, 'U5fHbZ29RvtkNLz7SVy2yv4OZ4D_uEjjFhApMOAypu8. "actions" : [ "context" : "", }, Wenn ich die eSIM auf der zurückgesetzten (leeren) Watch nochmals reaktivieren möchte bekomme ich von Vodafone die Meldung "Willkommen, Klasse, ist aktiviert" die Watch meldet per App jedoch "Mobilfunktarif kann nicht konfiguriert werden". So musst Du nicht mehr erst den Arm bewegen, damit der Bildschirm angeschaltet wird. LITHIUM.CustomEvent('.lia-custom-event', 'click'); { } "event" : "MessagesWidgetAnswerForm", "disableLinks" : "false", { ] }, ;(function($){ "disallowZeroCount" : "false", "actions" : [ else { }, } var notifCount = 0; { { // Oops. Hallo, Ich wollte  meine eSIM in der neuen Apple Watch 5 aktivieren.Doch funktioniert das wohl alles nicht so einfach wie ich dachte. }, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233708}); "context" : "", ], ] ] }); var count = 0; LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] "event" : "MessagesWidgetEditCommentForm", ] "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); } ] ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "ProductAnswer", LITHIUM.AjaxSupport.useTickets = false; LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'RGHg7GvOnvWw7s2V7bXzQKfwpGZZnoyjPLfF3uvLffI. }, })(LITHIUM.jQuery); $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "}); Stellen Sie vorab sicher, dass Ihr Mobilfunktarif auch die Apple Watch umfasst – nur dann können Sie sich autonom auf den Netzzugriff verlassen. $(this).next().toggle(); LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'RGHg7GvOnvWw7s2V7bXzQKfwpGZZnoyjPLfF3uvLffI. ] ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/4001/thread-id/56342","ajaxErrorEventName":"LITHIUM:ajaxError","token":"r_HeDNVe9z1KoCbSeoVf8KzPjIqe0i6Kt1YTSrRqPos. "context" : "", "event" : "addThreadUserEmailSubscription", ] } "context" : "envParam:quiltName", "kudosLinksDisabled" : "false", "context" : "", "context" : "envParam:quiltName", "action" : "rerender" "event" : "deleteMessage", "context" : "", "parameters" : { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ }, "; .attr('aria-expanded','false') "event" : "expandMessage", }, ] { // console.log(key); element.removeClass('active'); "actions" : [ "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetEditAnswerForm", ] "disallowZeroCount" : "false", } $(document).keydown(function(e) { } { "action" : "pulsate" LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '6hrLywUKYfFwFwEPnhvlnLdCyZ5i9Q38BHQ8TxcGrEU. }; "context" : "", { Beim Vodafone Support sagt man mir alles wäre ok. Anscheinend wird das esim Profil nicht auf die Watch üertragen, da auf der Watch im Bereich "Mobilen Netz" unter Tarif SIM fehlt eingetragen ist. "actions" : [ if(do_scroll == "true"){ { "initiatorDataMatcher" : "data-lia-message-uid" "parameters" : { Nach jedem inegrations versuch bekomme ich die Aussage vom Telefon das (Dein Mobilfunktarif konnte nicht konfiguriert werden.Versuch es später erneut) So die Meldung meines Telefons. Die EKG App ist nicht zur Verwendung durch Personen unter 22 Jahren gedacht. "parameters" : { "messageViewOptions" : "1111110111111111111110111110100101001101" { "}); }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "selector" : "#messageview", } }, var watching = false; "useSubjectIcons" : "true", "event" : "ProductAnswer", "actions" : [ } { "actions" : [ (Hätte gern Bilder eingefüght wie es ausschaut, aber das funktioniert mit keiner möglichkeit.. Upload, Fehler, URL EInfügen... Fehler). lithstudio: [], "event" : "removeMessageUserEmailSubscription", "event" : "unapproveMessage", }, }, "actions" : [ "revokeMode" : "true", "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); // --> "messageViewOptions" : "1111110111111111111110111110100101001101" "message" : "2210276", // Oops, not the right sequence, lets restart from the top. ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); ] LITHIUM.AjaxSupport.ComponentEvents.set({ { }); Problem gelöst. { count = 0; "useSimpleView" : "false", "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); Nov.. 2018 11:38 als Antwort auf videospezi ] "disallowZeroCount" : "false", // enable redirect to login page when "logmein" is typed into the void =) { "useSimpleView" : "false", "actions" : [ LITHIUM.Loader.runJsAttached(); "triggerEvent" : "LITHIUM:triggerDialogEvent", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswer", { }, }, "event" : "approveMessage", $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { "action" : "rerender" ] "forceSearchRequestParameterForBlurbBuilder" : "false", }, $('#vodafone-community-header').toggle(); { { }, watching = false; } var count = 0; }, ] "context" : "", "showCountOnly" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2210276 .lia-rating-control-passive', '#form_1'); // console.log('watching: ' + key); } "event" : "MessagesWidgetMessageEdit", } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); element.find('ul').slideUp(); } { watching = false; }, LITHIUM.AjaxSupport.useTickets = false; LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "quiltName" : "ForumMessage", }, { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/4001/thread-id/56342","ajaxErrorEventName":"LITHIUM:ajaxError","token":"3Qdn2bDkLiWa_zQD20f9_P6SsM1eAhZJPE9ewx8Grjw. "disableKudosForAnonUser" : "false", LITHIUM.Dialog.options['222798950'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; $('.lia-autocomplete-footer').append(ctaHTML); "parameters" : { { "actions" : [ "context" : "", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/4001/thread-id/56342","ajaxErrorEventName":"LITHIUM:ajaxError","token":"oGE3W-Wj9Mib66WbN_H7d62crg9Yiruae-8K1_Kd7LE. ] ] } } { "actions" : [ }, ] "action" : "rerender" }, LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2021949}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2022802}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2210276}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2211093}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515001}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540879}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2531322}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2530296}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519917}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542586}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2541658}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540954}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2539784}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2539323}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2539077}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2538541}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2536276}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2535993}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2535224}}]); ] $(event.data.selector).removeClass('cssmenu-open'); "action" : "pulsate" "context" : "envParam:quiltName,message", } "event" : "AcceptSolutionAction", var do_scroll = sessionStorage.is_scroll; }, { "context" : "envParam:quiltName,message", "}); var key = e.keyCode; "event" : "addMessageUserEmailSubscription", "useCountToKudo" : "false", { "action" : "rerender" ] Ich habe eine Apple Watch 5 und ein iPhone X. Softwareupdates sind alle gemacht, beide Geräte habe ich heute mehrmals neu gestartet und die Apple Watch auch schon ent- und wieder gekoppelt. { }, { Bist du sicher, dass du fortfahren möchtest? { ] "actions" : [ { LITHIUM.Dialog({ "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "deleteMessage", { $('#node-menu li.active').children('ul').show(); "context" : "envParam:quiltName", $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { ] "actions" : [ } "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", { }, "event" : "removeThreadUserEmailSubscription", "event" : "unapproveMessage", })(LITHIUM.jQuery); // Pull in global jQuery reference "defaultAriaLabel" : "", ', 'ajax'); "event" : "AcceptSolutionAction", "action" : "rerender" }, "context" : "", "action" : "rerender" } } ] }, { "parameters" : { "event" : "MessagesWidgetEditAction", "actions" : [ "disableLabelLinks" : "false", $(this).removeClass('active'); "revokeMode" : "true", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_70cd8b5b322dd8","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/4001/thread-id/56342&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Gut zu wissen: Eine Nutzung mit Android oder Windows Smartphones ist nicht möglich. $(this).next().toggle(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", } { })(LITHIUM.jQuery); "disableLinks" : "false", ] "actions" : [ } ] Nov.. 2018 09:15 als Antwort auf videospezi. }, "context" : "envParam:quiltName", "selector" : "#kudosButtonV2_0", } "context" : "", "selector" : "#kudosButtonV2", $('#community-menu-toggle').click(function() { "eventActions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ "event" : "QuickReply", "actions" : [ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "event" : "removeMessageUserEmailSubscription", "context" : "", "event" : "markAsSpamWithoutRedirect", }, ] ] { LITHIUM.Dialog({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/4001/thread-id/56342","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I8UxGGqDTHaUESbjuB8P686XsSe6VWZiZa0fPfHFTBI. $(this).toggleClass("view-btn-open view-btn-close"); count = 0; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:refresh_attachment_statuses","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#attachments_0_70cd8b78ea14cf","action":"refresh_attachment_statuses","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.attachments_0:refresh_attachment_statuses?t:ac=board-id/4001/thread-id/56342&t:cp=messages/contributions/messageviewparameterscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LdGMOtEJmMrOHcmW3S_RpoXhIq0iAsGe6XRoz8tS_ao. "actions" : [ ... Diese Datei kann nicht heruntergeladen werden. { { //}); "action" : "rerender" ] { "action" : "rerender" } } "event" : "kudoEntity", { { Hallo an die Community! ; Eine Apple-ID für dich selbst und eine für das Familienmitglied, das die Apple Watch verwendet.Für deine Apple-ID muss die Zwei-Faktor-Authentifizierung aktiviert sein. "context" : "", { Willkommen hier im Forum und danke für Deinen Beitrag! /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ ] LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:quiltName", "revokeMode" : "true", "action" : "rerender" { } ] LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); }, ] } $('.js-close-header-announcement').on('click', clickHandler); "event" : "removeMessageUserEmailSubscription", ] } Hallo. "actions" : [ "action" : "rerender" }

31 Ssw Unterleibsschmerzen, Diabetische Fußpflege Ausbildung Wien, Warum Keine Wehen 41 Ssw, Vegane Schnitzel Rewe, Haus Mieten Maxdorf Rheinpfalz, Fußpflege Ausbildung österreich,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.