callya app funktioniert nicht 2020

"actions" : [ }, "context" : "", } { } { { "message" : "1679260", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/59151","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7-hxjqIpXSKsN9RWwe8reogs6j4SxMAiYsbD08bVBUE. "displaySubject" : "true", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "event" : "AcceptSolutionAction", "event" : "MessagesWidgetEditAction", "quiltName" : "ForumMessage", "showCountOnly" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ } })(LITHIUM.jQuery); "kudosable" : "true", { }, "context" : "envParam:quiltName", }, ;(function($) { "showCountOnly" : "false", "action" : "rerender" Ist eine Sauerei von Vodafone, uns Fremdeinsteiger von damals heute als Kunden 3. }, "context" : "", "initiatorBinding" : true, if (event.target.matches('.redirect')) { var element = $(this).parent('li'); ', 'ajax'); ] ], "actions" : [ ] "action" : "rerender" } ] LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ ] { "actions" : [ "quiltName" : "ForumMessage", "event" : "deleteMessage", ] { ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} "actions" : [ { "context" : "", "event" : "editProductMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "displayStyle" : "horizontal", "actions" : [ "event" : "kudoEntity", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "}); "event" : "MessagesWidgetEditCommentForm", //resetMenu(); "event" : "MessagesWidgetEditAnswerForm", "actions" : [ CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); Top 10 best Audiobook & Podcast Android apps 2020. }, { "action" : "rerender" "actions" : [ { "dialogContentCssClass" : "lia-panel-dialog-content", "}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "AcceptSolutionAction", "event" : "unapproveMessage", { { "initiatorDataMatcher" : "data-lia-kudos-id" ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_38cc7d7a8ec643_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/89917&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] "action" : "rerender" "context" : "envParam:feedbackData", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "actions" : [ ] "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "includeRepliesModerationState" : "false", ] { ] "action" : "rerender" "useSimpleView" : "false", "context" : "envParam:feedbackData", LITHIUM.AjaxSupport.ComponentEvents.set({ { "disallowZeroCount" : "false", "actions" : [ // Set start to true only if the first key in the sequence is pressed "event" : "addThreadUserEmailSubscription", "event" : "addMessageUserEmailSubscription", "actions" : [ "actions" : [ "action" : "rerender" "event" : "addThreadUserEmailSubscription", } { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "useSimpleView" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { Execute whatever should happen when entering the right sequence }, { LITHIUM.AjaxSupport.ComponentEvents.set({ Vorklimatisierung funktioniert auch nicht. "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "action" : "rerender" { "actions" : [ "action" : "rerender" bei ...Teltarif sagt viel aus......Es reicht...bin kurz davor den Laden zu verlassen....Was soll man denn noch alles machen, dass man Datenvolumen buchen kann ?? "componentId" : "forums.widget.message-view", { }); ', 'ajax'); // Reset the conditions so that someone can do it all again. }, "context" : "envParam:quiltName,message", }, }, ] }, { { "disableLinks" : "false", "}); { { { "action" : "rerender" window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/Call-Ya-Aufladung-funktioniert-nicht/td-p/1676536" + "/page/" + 1; } "kudosLinksDisabled" : "false", } ] { count++; { Leider funktioniert die Callya Flex App wieder nicht- die App stürzt beim Aufrufen ab, das Einloggen ins VF Kundenkonto auf der Internet seite (außerhalb der App) funktioniert- aber das Buchen von Datenvolumen schlägt auch hier fehl....Anrufe an die VF Callya Team Kontaktnummer funktionieren ebensowenig. Update vom 08.05.2018, 11:25 Uhr: Vodafone hat die Probleme mit der CallYa-Flex-App behoben. LITHIUM.AjaxSupport.ComponentEvents.set({ Go back to your desktop, then click Go and click Go to Folder. LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { { "event" : "unapproveMessage", "actions" : [ }, "}); "componentId" : "forums.widget.message-view", } { "useSubjectIcons" : "true", "actions" : [ { }, "event" : "QuickReply", "actions" : [ } "action" : "rerender" "context" : "envParam:selectedMessage", "context" : "envParam:feedbackData", ] "actions" : [ } ] "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "entity" : "1679305", "context" : "envParam:feedbackData", $('#node-menu li.has-sub>a').on('click', function(){ { "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "actions" : [ } element.siblings('li').find('li').removeClass('active'); // --> } } "actions" : [ "event" : "expandMessage", "context" : "envParam:feedbackData", { } ] "disableLabelLinks" : "false", }); LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "selector" : "#kudosButtonV2_4", { }, "event" : "unapproveMessage", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { }, if ( key == neededkeys[0] ) { "actions" : [ "disableLinks" : "false", "action" : "addClassName" }, LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); }, "initiatorDataMatcher" : "data-lia-kudos-id" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "disableKudosForAnonUser" : "false", }, "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ { ] Wenn sich App-Updates nicht herunterladen lassen. LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/59151","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gu7BEinNscnwSOBr9yvKO5e25U1CfZcs7atrgdzLmlE. ] } { { "event" : "addMessageUserEmailSubscription", }, $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "action" : "rerender" ] "useCountToKudo" : "false", "revokeMode" : "true", "activecastFullscreen" : false, window.location = "https://forum.vodafone.de/t5/CallYa/Callya-Flex-funktioniert-nicht-kein-Buchen-von-Datenvolumen-und/td-p/2207316" + "/page/" + 1; "useTruncatedSubject" : "true", "truncateBody" : "true", ] var clickHandler = function(event) { "actions" : [ { "event" : "MessagesWidgetMessageEdit", ] "action" : "addClassName" "context" : "envParam:quiltName,expandedQuiltName", ] ] { "kudosable" : "true", "event" : "MessagesWidgetMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); { "actions" : [ LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234327}); "event" : "addThreadUserEmailSubscription", else { "context" : "", ] "event" : "MessagesWidgetMessageEdit", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "MessagesWidgetCommentForm", "selector" : "#messageview_0", } { "truncateBodyRetainsHtml" : "false", }, "action" : "rerender" // Set start to true only if the first key in the sequence is pressed "actions" : [ }, { "componentId" : "forums.widget.message-view", $(document).ready(function(){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "actions" : [ ] { "forceSearchRequestParameterForBlurbBuilder" : "false", } }, "actions" : [ }, ] ;(function($) { "action" : "pulsate" { }, "event" : "ProductMessageEdit", ] } "actions" : [ "useSimpleView" : "false", } ] LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, ] $(document).ready(function(){ "action" : "rerender" } }, })(LITHIUM.jQuery); return; "event" : "approveMessage", "context" : "envParam:selectedMessage", }, // console.log(key); "useSubjectIcons" : "true", } "disableLinks" : "false", { }, var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "triggerEvent" : "click", "context" : "envParam:entity", }, ] } ] "event" : "AcceptSolutionAction", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'uRty7BqMqHRExFKGAwYMzSZHZNmg88z6ZMqUs8E9UxI. } "action" : "rerender" }else{ "actions" : [ "action" : "rerender" ] }, } } "initiatorDataMatcher" : "data-lia-message-uid" }); "message" : "1679260", "context" : "lia-deleted-state", }, }, } { ;(function($){ "context" : "lia-deleted-state", ] ] }, "action" : "pulsate" }, } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "action" : "pulsate" "disableLinks" : "false", } LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "action" : "rerender" }, { }, { } "eventActions" : [ "actions" : [ { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89917","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BaIHFORxv7CC62IjiDvuR8DX_rYc_ucAhntXHq6cQ9U. { element.siblings('li').removeClass('active'); "event" : "approveMessage", } ', 'ajax'); "context" : "", { } // just for convenience, you need a login anyways... return; var clickedDomElement = $(this); } "context" : "lia-deleted-state", }, ] LITHIUM.Dialog.options['-892400015'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; }, }, })(LITHIUM.jQuery); }, } else { { count = 0; "context" : "", }, } { "actions" : [ "entity" : "1679260", "useSubjectIcons" : "true", { }, "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", } "actions" : [ "kudosLinksDisabled" : "false", })(LITHIUM.jQuery); { "selector" : "#kudosButtonV2_4", { } Execute whatever should happen when entering the right sequence }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, var keycodes = { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1681439,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "message" : "1681439", $(this).toggleClass("view-btn-open view-btn-close"); { "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "action" : "rerender" }, "action" : "pulsate" "includeRepliesModerationState" : "false", //$(window).scroll(function() { "event" : "deleteMessage", "event" : "expandMessage", { ] }, "forceSearchRequestParameterForBlurbBuilder" : "false", var resetMenu = function() { { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ } { "actions" : [ LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "showCountOnly" : "false", }, }); } "initiatorDataMatcher" : "data-lia-kudos-id" { "context" : "", }, "context" : "envParam:selectedMessage", "context" : "envParam:quiltName", { LITHIUM.AjaxSupport.ComponentEvents.set({ } ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", var msg = $(".message-uid-2216057"); //if(height > 430) { "context" : "lia-deleted-state", "action" : "rerender" } "revokeMode" : "true", "context" : "", "componentId" : "kudos.widget.button", "disableKudosForAnonUser" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'k5VnTZZDjLahVfjV6_VlmXHyOXy2dgdkjLRniCvHmf4. ... Mein Auto steht laut App gar nicht vor der Tür. "}); "actions" : [ "action" : "rerender" "initiatorBinding" : true, { User am 23 August, 2020 Ich habe nichts gemacht es hat 4-5 Wochen nicht funktioniert und dann auf einmal funktionierte es. "context" : "lia-deleted-state", "action" : "rerender" "actions" : [ } "actions" : [ }, }, "actions" : [ "disableLinks" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89917","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BaIHFORxv7CC62IjiDvuR8DX_rYc_ucAhntXHq6cQ9U. } "dialogKey" : "dialogKey" "}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "showCountOnly" : "false", "action" : "rerender" { "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "event" : "MessagesWidgetEditAction", { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/59151","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7-hxjqIpXSKsN9RWwe8reogs6j4SxMAiYsbD08bVBUE. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/59151","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-WmKMvS-3l9_ybh_dovKcZbNuvloCVO1DC6MuStqNsk. { "action" : "rerender" }, } ] "event" : "MessagesWidgetCommentForm",

Plötzlicher Wutanfall Kreuzworträtsel, Mythos Wahlbach Telefonnummer, Alpine Bergtouren Allgäu, Sonderzahlungen Hartz 4-empfänger, Gewitzt, Pfiffig 6 Buchstaben, übergangsjacke Herren Business, Caritas Rastatt Telefonnummer, Teil 3 Der Meisterprüfung, Silvester In Tabarz,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.