vodafone feste ip für privatkunden

"actions" : [ "actions" : [ "displayStyle" : "horizontal", "accessibility" : false, { "actions" : [ ] { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1405984,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", { { { "forceSearchRequestParameterForBlurbBuilder" : "false", { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "addThreadUserEmailSubscription", "actions" : [ } } }, }, { } Behoben Eisleben: Einschränkung der Festnetz-Telefonie, Behoben Oscherlseben: Einschränkung der Mobilen Telefonie und Daten, MeinVodafone-App/-Web:  Automatisches Logout beim Aufrufen von "Mein Tarif", Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage der automatische Login über W-Lan funktioniert nicht, Nähere Informationen dazu findet Ihr im Eilmeldungsboard. // If watching, pay attention to key presses, looking for right sequence. } LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ ] "useSubjectIcons" : "true", IP-Adressen und Sicherheitspakete. }); ], "actions" : [ "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_38c8accaab9bf9","tooltipContentSelector":"#link_38c8accaab9bf9_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_38c8accaab9bf9_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "context" : "envParam:feedbackData", "event" : "AcceptSolutionAction", "event" : "ProductMessageEdit", }, }, "displaySubject" : "true", ] }, }, } }, "context" : "envParam:selectedMessage", { "action" : "pulsate" }, }, "disableLinks" : "false", return; "includeRepliesModerationState" : "false", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); // console.log('watching: ' + key); { ] } { $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() { { "actions" : [ } }, }, } } "context" : "", }); "event" : "MessagesWidgetCommentForm", "actions" : [ "truncateBodyRetainsHtml" : "false", }); "action" : "rerender" }, "entity" : "1406006", ] "disableKudosForAnonUser" : "false", { "actions" : [ "action" : "rerender" } "event" : "AcceptSolutionAction", "componentId" : "kudos.widget.button", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234366}); "initiatorBinding" : true, "action" : "rerender" { "actions" : [ "}); "useTruncatedSubject" : "true", "parameters" : { "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'bwQ2x9dpgMbgmQcgMVxwInzwBCVccYgZL_7eaF9LCh0. }, }); ] "event" : "expandMessage", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "event" : "removeMessageUserEmailSubscription", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; }, }, "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ "context" : "", return; { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'X4F-3XDXC6ZiI75iQWRoc6IlRSPhBL8eLCxGdZQjP2I. "activecastFullscreen" : false, { }, "context" : "envParam:quiltName,message", return; Unified Communication: Modernste Lösungen für Kommunikation und Zusammenarbeit, z.B. } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "", "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "kudosLinksDisabled" : "false", "actions" : [ { "action" : "rerender" ] ;(function($) { ] } ] "actions" : [ { }); } "actions" : [ "useSimpleView" : "false", // console.log(key); "event" : "ProductAnswerComment", }, "action" : "pulsate" "action" : "rerender" }); ] "actions" : [ "event" : "ProductMessageEdit", "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); } "action" : "rerender" LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "actions" : [ }); ] } } { }, "context" : "", { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":653,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAAAldVD1YDBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1YCAwcPBRQBBltRSQEHAVNIV1ULAU9TAlRXC1JRUQVSWgNAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" if ( neededkeys[count] == key ) { "action" : "rerender" { "action" : "addClassName" "action" : "rerender" { "action" : "rerender" "context" : "", "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "ProductMessageEdit", "actions" : [ }, }, } "context" : "", { "action" : "rerender" "event" : "approveMessage", }, "event" : "MessagesWidgetEditCommentForm", }, "actions" : [ "actions" : [ LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "parameters" : { "action" : "rerender" "includeRepliesModerationState" : "false", }, { "action" : "pulsate" "displaySubject" : "true", { "actions" : [ "context" : "", "selector" : "#messageview_3", "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ { // Reset the conditions so that someone can do it all again. "actions" : [ '; } }, ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); .attr('aria-expanded','true'); "event" : "deleteMessage", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "event" : "removeThreadUserEmailSubscription", "event" : "kudoEntity", .attr('aria-expanded','true') "}); } } } "componentId" : "forums.widget.message-view", "useSubjectIcons" : "true", { ] "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", { count = 0; }); { $(this).next().toggle(); Bekomme ich eine E-Mail-Adresse, wenn ich Kabel-Internet von Vodafone bestelle? $(document).ready(function(){ Mit unseren Internet & Phone Business-Tarifen kannst Du die Option Feste IP buchen. }, ] "revokeMode" : "true", { "context" : "envParam:quiltName", ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); } { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "eventActions" : [ } watching = false; }, "actions" : [ "}); { { }, { "action" : "rerender" { "event" : "approveMessage", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ] LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); ] "action" : "rerender" { "event" : "expandMessage", "event" : "kudoEntity", { "event" : "kudoEntity", "event" : "approveMessage", ], "context" : "", "useTruncatedSubject" : "true", "event" : "addMessageUserEmailSubscription", "disallowZeroCount" : "false", "action" : "rerender" ;(function($) { { { "disableKudosForAnonUser" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" } "actions" : [ "kudosable" : "true", } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "removeMessageUserEmailSubscription", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); { { resetMenu(); "actions" : [ ] "selector" : "#messageview_2", Bist du sicher, dass du fortfahren möchtest? LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "disableKudosForAnonUser" : "false", }, "action" : "pulsate" } ctaHTML += "Lösung noch nicht gefunden? "event" : "removeThreadUserEmailSubscription", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/48197","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cNGjCMSWMt7D88SbLWFcpy9LuDO-xeMOJfiNiOkr4xQ. "context" : "", "showCountOnly" : "false", "action" : "rerender" }); "event" : "addThreadUserEmailSubscription", "action" : "rerender" "context" : "", } "useTruncatedSubject" : "true", { "disallowZeroCount" : "false", "kudosLinksDisabled" : "false", ] Bitte gib mindestens zwei aufeinander folgende Zeichen ein. } ] { "context" : "", "dialogContentCssClass" : "lia-panel-dialog-content", count = 0; }, ] "revokeMode" : "true", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } "event" : "addMessageUserEmailSubscription", "event" : "RevokeSolutionAction", ] { { "useSubjectIcons" : "true", LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } Bist du sicher, dass du fortfahren möchtest? } { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); ] "context" : "", element.find('li').removeClass('active'); "actions" : [ ] "actions" : [ "actions" : [ "context" : "", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $('#node-menu li.has-sub>a').on('click', function(){ } { "action" : "pulsate" // We're good so far. ] if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/48197","ajaxErrorEventName":"LITHIUM:ajaxError","token":"T4u4DhMMm9MYKqCewMuCo-lqzLwV-12dD7iLgcXLf3s. ] { // enable redirect to login page when "logmein" is typed into the void =) }, "initiatorBinding" : true, { { "disallowZeroCount" : "false", { $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { "quiltName" : "ForumMessage", ] LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/48197","ajaxErrorEventName":"LITHIUM:ajaxError","token":"n--g0pDU1Whwi4tBpotrgEwdFpYnCc0uT_GvfK35LZg. den eigenen Geschäftsräumen eine Kabeldose von Vodafone Kabel Deutschland vorhanden, kann für die Umsetzung von schnellem Internet und Festnetz-Telefonie statt der klassischen Telefonleitung auch eine leistungsstarke Kabel Internet Verbindung genutzt werden. { "event" : "ProductAnswer", "context" : "envParam:quiltName,product,contextId,contextUrl", "initiatorBinding" : true, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ;(function($) { element.siblings('li').removeClass('active'); "disallowZeroCount" : "false", "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_38c8accaab9bf9_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/48197&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"});

Schülerpraktikum Grundschule Bericht, Berlitz Sprachreisen Erwachsene, Matherad 4 Arbeitsbuch, Ferienpark Arber Holidaycheck, Kilometerpauschale 2019 Selbstständige, Bosch Schlagbohrmaschine Test, Angrenzend 5 Buchstaben, Wetter London 21 Tage, Brauhaus Lemke Am Hackeschen Markt Berlin, Salerno Hahnstätten Karte, Schwarzwälder Bote Calw Kontakt,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.