mein vodafone app öffnet nicht

","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); // enable redirect to login page when "logmein" is typed into the void =) var keycodes = { }, "action" : "rerender" "action" : "pulsate" "actions" : [ "event" : "MessagesWidgetCommentForm", $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "actions" : [ } { "action" : "addClassName" "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "linkDisabled" : "false" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); ] "event" : "kudoEntity", ;(function($) { watching = false; ] { { "initiatorDataMatcher" : "data-lia-kudos-id" "initiatorBinding" : true, "initiatorBinding" : true, ] "buttonDialogCloseAlt" : "Schließen", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "event" : "deleteMessage", { "accessibility" : false, Einmal gekaufte Apps können Sie kostenlos erneut herunterladen, wenn Sie dies über die gleiche Apple-ID tun. { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); // enable redirect to login page when "logmein" is typed into the void =) "context" : "", { "context" : "envParam:quiltName", } "truncateBodyRetainsHtml" : "false", { { "actions" : [ { } } } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); ], } } "event" : "editProductMessage", ] "event" : "addThreadUserEmailSubscription", { return; }, }, "event" : "ProductAnswerComment", "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "includeRepliesModerationState" : "false", "event" : "MessagesWidgetEditAction", $(document).ready(function(){ Bist du sicher, dass du fortfahren möchtest? "truncateBody" : "true", "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" }, "action" : "rerender" }, ] "event" : "RevokeSolutionAction", "disableKudosForAnonUser" : "false", "displayStyle" : "horizontal", "componentId" : "forums.widget.message-view", "actions" : [ "action" : "rerender" }, ] { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":678,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewNQXE80WABUVVtcABsrXFsMT3wFV1ZYbkp7A1BcB09hC1FSUl0LU0t4QhJPRBBUQUBXERsIUFEKFmtLQVcZQjkZVwwAVFEEUBcfFlQXVwtcewZADVUHBwILUQJVAAZVVBtGXlBhQQBEL10QWE8GSBdYV2IEUQN3Uw8HFV4XdVtAEFsyVkILAWcFUlYWHkddBXRdAAtbARcJFlQEWhVcEE5AXAd3XEAQXxQAWF4RBxVIF1hXZh0UXBsCA1sGAANSUR8EBVEKH1YDD10YCgBXVxtTXQcABg5RBFJVBVQUShtZASxYAFB6UBBfFCdLUQoLQSlQWlpkClIHX10MB3oBXF1\/UwdTCnx\/AwtbRhkRX1E3UxVNZFAzQgFHShYIR2UjdXchNhcNURNyYCp7RlRXERFWA1BAFGUtczR8EhYNRw1WHV1WWAlGdXsvK2NEChFJTw=="}. { { "actions" : [ }, { "showCountOnly" : "false", "action" : "rerender" "event" : "kudoEntity", ] "action" : "rerender" window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":678,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewNQXE80WABUVVtcABsrXFsMT3wFV1ZYbkp7A1BcB09hC1FSUl0LU0t4QhJPRBBUQUBXERsIUFEKFmtLQVcZQjkZVwwAVFEEUBcfFlQXVwtcewZADVUHBwILUQJVAAZVVBtGXlBhQQBEL10QWE8GSBdYV2IEUQN3Uw8HFV4XdVtAEFsyVkILAWcFUlYWHkddBXRdAAtbARcJFlQEWhVcEE5AXAd3XEAQXxQAWF4RBxVIF1hXZh0UXBsCA1sGAANSUR8EBVEKH1YDD10YCgBXVxtTXQcABg5RBFJVBVQUShtZASxYAFB6UBBfFCdLUQoLQSlQWlpkClIHX10MB3oBXF1\/UwdTCnx\/AwtbRhkRX1E3UxVNZFAzQgFHShYIR2UjdXchNhcNURNyYCp7RlRXERFWA1BAFGUtczR8EhYNRw1WHV1WWAlGdXsvK2NEChFJTw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); ] "event" : "AcceptSolutionAction", { { "event" : "MessagesWidgetAnswerForm", "useCountToKudo" : "false", ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_1edccd7200bcbf","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { { if ( neededkeys[count] == key ) { { "context" : "", }, "useTruncatedSubject" : "true", })(LITHIUM.jQuery); in „Filme/Serien“. "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" "parameters" : { "buttonDialogCloseAlt" : "Schließen", { "linkDisabled" : "false" "actions" : [ } { ] { ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); { { { { "actions" : [ { "disableLabelLinks" : "false", "event" : "addMessageUserEmailSubscription", "event" : "unapproveMessage", } "context" : "", { { } { "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ }, }); { { "event" : "deleteMessage", { ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); ] { "actions" : [ } "event" : "deleteMessage", "event" : "addMessageUserEmailSubscription", ] "selector" : "#messageview_1", "actions" : [ ] "event" : "editProductMessage", { ] { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574219 .lia-rating-control-passive', '#form_4'); LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ] LITHIUM.AjaxSupport.ComponentEvents.set({ }; "event" : "MessagesWidgetEditAnswerForm", "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "approveMessage", } Execute whatever should happen when entering the right sequence "disableLabelLinks" : "false", { ] "context" : "", Sprich wenn ich auf das Icon... Dieses Thema im Forum "Windows 10 Support" wurde erstellt von … "componentId" : "forums.widget.message-view", } }, }, "context" : "envParam:selectedMessage", }, }, }, ] LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "kudosable" : "true", count = 0; ] "event" : "MessagesWidgetCommentForm", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "componentId" : "kudos.widget.button", "context" : "", "actions" : [ "actions" : [ { Tritt der Fehler nur bei einer App auf, löschen Sie die Anwendung einfach und laden Sie diese anschließend erneut aus dem App Store herunter. "action" : "rerender" "action" : "rerender" LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "event" : "QuickReply", ], }, }, { "disallowZeroCount" : "false", "action" : "rerender" "event" : "MessagesWidgetMessageEdit", }); watching = false; "actions" : [ }, { "useSubjectIcons" : "true", { { ] ] LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); }, }, { var clickHandler = function(event) { { { { "context" : "envParam:selectedMessage", } count = 0; "action" : "rerender" "selector" : "#messageview_0", "action" : "rerender" "context" : "", }, { "actions" : [ LITHIUM.Loader.runJsAttached(); "action" : "rerender" }, } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { { } { { ] "actions" : [ "showCountOnly" : "false", "action" : "pulsate" { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "addClassName" } { { "event" : "ProductMessageEdit", "context" : "envParam:quiltName", "triggerEvent" : "click", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswer", "action" : "rerender" "actions" : [ }, "action" : "rerender" ] }; "selector" : "#messageview_4", { { ] "context" : "lia-deleted-state", "action" : "rerender" return; ', 'ajax'); "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" { ], "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,expandedQuiltName", { "event" : "addMessageUserEmailSubscription", // We're good so far. if ( watching ) { }, "actions" : [ } ] "event" : "expandMessage", }); LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:quiltName", "event" : "kudoEntity", "includeRepliesModerationState" : "false", }, "context" : "", }, }, ] "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { "event" : "unapproveMessage", "componentId" : "kudos.widget.button", "linkDisabled" : "false" "actions" : [ "context" : "envParam:quiltName,message", "actions" : [ "event" : "MessagesWidgetAnswerForm", { LITHIUM.Dialog({ "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "event" : "unapproveMessage", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "action" : "rerender" ] "useCountToKudo" : "false", "action" : "rerender" } { "context" : "", } } else { } "action" : "addClassName" ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, return; "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", { "action" : "rerender" { "quiltName" : "ForumMessage", "componentId" : "forums.widget.message-view", ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "linkDisabled" : "false" }, "context" : "envParam:selectedMessage", "action" : "pulsate" "revokeMode" : "true", "displayStyle" : "horizontal", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "removeMessageUserEmailSubscription", }, { "includeRepliesModerationState" : "false", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8SiRxuIYnvC0iJsla6iJnMCO_ZHObch_4YZr0q0fuWg. { "action" : "rerender" ], ] ] }, ] { ] LITHIUM.AjaxSupport.ComponentEvents.set({ "forceSearchRequestParameterForBlurbBuilder" : "false", } { ] "actions" : [ "event" : "editProductMessage", ] } "displayStyle" : "horizontal", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "action" : "rerender" "action" : "rerender" "actions" : [ ] ] "context" : "", "context" : "envParam:feedbackData", } "context" : "", } "context" : "", { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetAnswerForm", if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { { "event" : "MessagesWidgetCommentForm", { "event" : "MessagesWidgetMessageEdit", if ( count == neededkeys.length ) { "context" : "", } }, "event" : "MessagesWidgetEditCommentForm", "revokeMode" : "true", "action" : "rerender" "context" : "", "context" : "", "event" : "expandMessage", "action" : "rerender" }, "context" : "envParam:quiltName", "actions" : [ var ctaHTML = ''; "useCountToKudo" : "false", // console.log('watching: ' + key); { "selector" : "#kudosButtonV2_4", { "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:quiltName", }, "event" : "approveMessage", "context" : "", } "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ }, "quiltName" : "ForumMessage", "initiatorDataMatcher" : "data-lia-kudos-id" { }, ], ], "event" : "MessagesWidgetCommentForm", "event" : "ProductAnswerComment", { "context" : "lia-deleted-state", } "actions" : [ } "event" : "addMessageUserEmailSubscription", { "accessibility" : false, { } } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "eventActions" : [ "showCountOnly" : "false", resetMenu(); "context" : "", "actions" : [ "showCountOnly" : "false", ] "actions" : [ ] ], { "action" : "rerender" ] } "actions" : [ "action" : "rerender" "parameters" : { "forceSearchRequestParameterForBlurbBuilder" : "false", var count = 0; "forceSearchRequestParameterForBlurbBuilder" : "false", "eventActions" : [ "event" : "MessagesWidgetEditCommentForm", "event" : "ProductMessageEdit", ] $(this).toggleClass("view-btn-open view-btn-close"); $(document).ready(function(){ LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "useSubjectIcons" : "true", "disallowZeroCount" : "false", $('li.close-on-click').on('click',resetMenu); "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" $(this).toggleClass("view-btn-open view-btn-close"); .attr('aria-selected','false'); }, }, { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "selector" : "#kudosButtonV2_4", "initiatorBinding" : true, } "action" : "rerender" "action" : "rerender" ;(function($) { } "event" : "QuickReply", { .attr('aria-hidden','false') }, "actions" : [ { "action" : "rerender" }, "actions" : [ "disallowZeroCount" : "false", "context" : "envParam:quiltName,message", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "actions" : [ "initiatorBinding" : true, } "action" : "rerender" if ( !watching ) { Ich habe einen … ;(function($) { "action" : "rerender" event.returnValue = false; { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_1edccd7200bcbf_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); element.find('ul').slideUp(); "action" : "rerender" } }, "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bPGaZTqyTUtZJHUgRAPNLmT7qd7TUMA804V01k9Kqbw. "event" : "MessagesWidgetEditCommentForm", { "action" : "rerender" "context" : "", { "action" : "rerender" ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "context" : "", }, { ] "truncateBodyRetainsHtml" : "false", "useSubjectIcons" : "true", "action" : "rerender" "action" : "rerender" } ] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ }, "entity" : "1574243", }, "actions" : [ "actions" : [ "event" : "unapproveMessage", "event" : "MessagesWidgetEditAction", ] }, "displaySubject" : "true", "actions" : [ "disableLinks" : "false", ] ] "action" : "rerender" "context" : "envParam:selectedMessage", setCookie: function(cookieName, cookieValue) { } "event" : "addThreadUserEmailSubscription", }, "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '8XEBwYnSPx-eP2Slc6gFNp1ACtvlz03AUucolzndRyk. "linkDisabled" : "false" "eventActions" : [ "eventActions" : [ "initiatorDataMatcher" : "data-lia-message-uid" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:quiltName,message", { { { "event" : "MessagesWidgetEditAnswerForm", "quiltName" : "ForumMessage", LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.

Krankenhaus Regeln Corona Nrw, Maritim Hotel München Adresse, Fahrtkosten Abrechnen Vorlage, Hangman - The Killing Game Inhalt, Omas Sauerkraut Mit Stampfkartoffeln, Kinderflohmarkt Kemnader See Erfahrungen, Beispiel Indirektes Zitat, Hartz 4 Auszahlung, Personalabteilung Unimedizin Mainz,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.