vodafone bridge mode ipv4

{ { ] { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "event" : "expandMessage", "event" : "addMessageUserEmailSubscription", }, document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); }, ] } "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", { "action" : "rerender" "action" : "addClassName" }, "eventActions" : [ "action" : "rerender" "actions" : [ { } } ] "event" : "kudoEntity", "action" : "rerender" "useSimpleView" : "false", { "actions" : [ "kudosable" : "true", "useCountToKudo" : "false", { ] "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); ] "actions" : [ } } "action" : "pulsate" { } "context" : "", { // If watching, pay attention to key presses, looking for right sequence. "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, // enable redirect to login page when "logmein" is typed into the void =) { "action" : "rerender" "actions" : [ "componentId" : "kudos.widget.button", ] "context" : "", } ] }, ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "initiatorBinding" : true, ] LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "accessibility" : false, "action" : "rerender" "useCountToKudo" : "false", { "actions" : [ ] "}); "linkDisabled" : "false" } }, }, } "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2051986 .lia-rating-control-passive', '#form_6'); { ] }, ] } "context" : "", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { "action" : "rerender" ] "displayStyle" : "horizontal", ] "context" : "envParam:quiltName,message", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "event" : "ProductAnswerComment", ] }, { $(document).ready(function(){ }, ] "actions" : [ "actions" : [ "context" : "envParam:quiltName", ] "action" : "rerender" { LITHIUM.Dialog.options['-168828184'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "parameters" : { "event" : "deleteMessage", "message" : "2052024", }, }); { ] "action" : "rerender" "event" : "ProductAnswerComment", "actions" : [ "event" : "unapproveMessage", } "initiatorBinding" : true, ] }, ] }, "action" : "rerender" "actions" : [ { ', 'ajax'); ] "action" : "rerender" } { "context" : "", "quiltName" : "ForumMessage", ] LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; count = 0; "accessibility" : false, "truncateBody" : "true", o.innerHTML = ""; "context" : "envParam:feedbackData", { "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "addMessageUserEmailSubscription", "initiatorBinding" : true, "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "parameters" : { }, ] { "action" : "rerender" "actions" : [ "initiatorBinding" : true, { { } "actions" : [ "context" : "envParam:quiltName", }, "actions" : [ } "actions" : [ { "disableLabelLinks" : "false", { $('#node-menu li.active').children('ul').show(); "initiatorBinding" : true, "action" : "rerender" { ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ ] "action" : "rerender" "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); ] "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" { }, { ], } { { "initiatorBinding" : true, "disableLabelLinks" : "false", "truncateBody" : "true", "context" : "", } "actions" : [ "action" : "pulsate" }, "initiatorDataMatcher" : "data-lia-message-uid" "event" : "MessagesWidgetEditAction", "event" : "MessagesWidgetAnswerForm", } "actions" : [ { bridge br2} description "Vodafone Voice" mac MIOMAC} ... ipv4 {forwarding enable gre enable ... password vodafone}} mode local} client-ip-pool "actions" : [ } "context" : "", "event" : "removeMessageUserEmailSubscription", "kudosLinksDisabled" : "false", "; "actions" : [ "truncateBodyRetainsHtml" : "false", "parameters" : { }); ] "context" : "", } LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "context" : "lia-deleted-state", "event" : "editProductMessage", "componentId" : "forums.widget.message-view", o.innerHTML = "Page must be in a numeric format. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetMessageEdit", { o.innerHTML = ""; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/105041","ajaxErrorEventName":"LITHIUM:ajaxError","token":"urfPrn5Kto_JA9VMS635J4Rk-XmDiytQIjxrMBcObRQ. "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "action" : "addClassName" } }, }, Vodafone ] "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ //$(window).scroll(function() { "parameters" : { "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { }, "context" : "", "actions" : [ { "actions" : [ }, ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); } "event" : "MessagesWidgetEditAnswerForm", "context" : "", "context" : "", "entity" : "2051986", { ] ] // Oops, not the right sequence, lets restart from the top. } "event" : "addMessageUserEmailSubscription", "action" : "pulsate" "event" : "MessagesWidgetMessageEdit", }, { "disallowZeroCount" : "false", "selector" : "#kudosButtonV2_6", ] "message" : "2049756", { "action" : "rerender" "disallowZeroCount" : "false", } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ } "event" : "approveMessage", { ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'kvDhNm_b_q9H5V_UTTIVSegqqhi_W5G_OjuNP3PLGz0. "event" : "removeMessageUserEmailSubscription", { "actions" : [ "event" : "expandMessage", "disallowZeroCount" : "false", "context" : "", { { "action" : "rerender" ] }; Hope this helps. { vielen Dank für die Hilfe. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "linkDisabled" : "false" { } }, "actions" : [ { LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); o.innerHTML = "Page number must be 1 or greater. ', 'ajax'); { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"});

Apple Watch Ohne Esim Nutzen, Laurel And Hardy Robinson Crusoe Island, Dr Maier Frauenärztin, Zuber Gmbh Metzgerei, Pizza Point Bad Kreuznach Telefonnummer, Indisches Curry Vegetarisch Blumenkohl,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.