vodafone station bridge mode dual stack

}, { { "event" : "ProductMessageEdit", "action" : "rerender" { "actions" : [ { }, }, { "activecastFullscreen" : false, }, var watching = false; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "}); { "event" : "expandMessage", '; "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" } } if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") { "initiatorBinding" : true, "action" : "rerender" "actions" : [ "event" : "addThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); } "event" : "editProductMessage", "event" : "QuickReply", "event" : "removeMessageUserEmailSubscription", { "context" : "", "kudosable" : "true", "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "action" : "rerender" "componentId" : "kudos.widget.button", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "MessagesWidgetEditCommentForm", }, }, ] ] { }, ] "context" : "envParam:selectedMessage", if (1 != val) "actions" : [ "; "actions" : [ } "truncateBody" : "true", }, ], "action" : "rerender" "actions" : [ "actions" : [ }, } "event" : "kudoEntity", { { "context" : "", "action" : "rerender" { } if ( Number(val) < 1 ) } "eventActions" : [ "componentId" : "forums.widget.message-view", "actions" : [ "actions" : [ "context" : "envParam:feedbackData", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "action" : "rerender" ;(function($) { "disableLinks" : "false", "actions" : [ "context" : "", "action" : "rerender" { "event" : "RevokeSolutionAction", ] "parameters" : { Mit der neuen Vodafone Station will das nicht mehr funktionieren. "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } ] { { "parameters" : { } $(this).toggleClass("view-btn-open view-btn-close"); "actions" : [ "actions" : [ }, { }); { }, "action" : "rerender" } { }, "event" : "expandMessage", "triggerEvent" : "click", "context" : "envParam:feedbackData", "action" : "pulsate" "context" : "envParam:selectedMessage", }); "event" : "expandMessage", "actions" : [ ] "event" : "MessagesWidgetCommentForm", } { "disableLabelLinks" : "false", "event" : "QuickReply", "action" : "addClassName" } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "actions" : [ "kudosable" : "true", "context" : "envParam:quiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); } { ] "quiltName" : "ForumMessage", }, { }, "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "", { CookieManager = { "action" : "rerender" "context" : "envParam:feedbackData", "actions" : [ "event" : "removeMessageUserEmailSubscription", } } ] ] { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "lia-deleted-state", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addMessageUserEmailSubscription", // We made it! { }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/74551","ajaxErrorEventName":"LITHIUM:ajaxError","token":"rL7_ipiZmd88DhHP8qVZPxynGVvW1boI9YeMvN8B7OI. }, "action" : "rerender" { { ] ] "event" : "MessagesWidgetCommentForm", "eventActions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "unapproveMessage", "kudosable" : "true", "actions" : [ "action" : "rerender" "event" : "markAsSpamWithoutRedirect", }, LITHIUM.AjaxSupport.ComponentEvents.set({ "message" : "1682289", }, "context" : "", { { ] LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Bist du sicher, dass du fortfahren möchtest? ] ] } { } "actions" : [ "disableLabelLinks" : "false", { { "event" : "unapproveMessage", "actions" : [ "action" : "rerender" "actions" : [ ] "disallowZeroCount" : "false", { "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", { } ] ;(function($) { ] { { } }, setWarning(pagerId); } }, "event" : "approveMessage", "quiltName" : "ForumMessage", "actions" : [ "actions" : [ } ] "action" : "pulsate" "context" : "", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "removeThreadUserEmailSubscription", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); { ] ] } "action" : "rerender" //if(height > 430) { "action" : "rerender" { "event" : "addMessageUserEmailSubscription", ] } "event" : "removeThreadUserEmailSubscription", { ] "context" : "envParam:selectedMessage", "action" : "rerender" ] "actions" : [ "action" : "rerender" { { }, { ] "actions" : [ { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); watching = false; { { ] }, { "action" : "rerender" }, { } "action" : "rerender" { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" { } "actions" : [ ] "componentId" : "kudos.widget.button", }); if ( !watching ) { }, { { "context" : "", "context" : "", "message" : "1682164", { { o.innerHTML = "Page must be an integer number. ] "action" : "addClassName" "context" : "envParam:quiltName", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1682313 .lia-rating-control-passive', '#form_8'); o.innerHTML = ""; "selector" : "#messageview_7", { }, { LITHIUM.Dialog({ "displaySubject" : "true", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", // We're good so far. "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "actions" : [ "action" : "rerender" ] Nein, das geht leider nicht. { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "AcceptSolutionAction", "action" : "rerender" }); }, "action" : "pulsate" } "event" : "removeThreadUserEmailSubscription", { ] "event" : "MessagesWidgetMessageEdit", "messageViewOptions" : "1111110111111111111110111110100101001101" } }, ] }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", "triggerEvent" : "click", "actions" : [ } ] "forceSearchRequestParameterForBlurbBuilder" : "false", }, { "event" : "MessagesWidgetEditAnswerForm", "}); "disableLabelLinks" : "false", { "action" : "rerender" }, "useCountToKudo" : "false", } "disableLabelLinks" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, { "useSubjectIcons" : "true", "actions" : [ ] "event" : "removeMessageUserEmailSubscription", "action" : "rerender" if ( count == neededkeys.length ) { "initiatorBinding" : true, "action" : "rerender" { "messageViewOptions" : "1111110111111111111110111110100101001101" { } ] "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); zoschel. "event" : "kudoEntity", } ] return; } { "actions" : [ "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" { { }); "entity" : "1682363", }, "action" : "pulsate" { ] ], } { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "useCountToKudo" : "false", { { "action" : "rerender" // enable redirect to login page when "logmein" is typed into the void =) { "action" : "rerender" "useSimpleView" : "false", { "action" : "rerender" "event" : "addThreadUserEmailSubscription", }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "displayStyle" : "horizontal", "actions" : [ "context" : "", { }, "actions" : [ "disableKudosForAnonUser" : "false", { ] ;(function($) { "parameters" : { "actions" : [ "context" : "", "disableKudosForAnonUser" : "false", "event" : "markAsSpamWithoutRedirect", Achtung, es folgt eine Signatur: Wenn überhaupt, dann jammern wir auf einem extrem hohen Niveau. ] }, "event" : "MessagesWidgetAnswerForm", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ }, { { if ( key == neededkeys[0] ) { ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } }, "truncateBodyRetainsHtml" : "false", { The wireless clients are in the same subnet as the clients connected to the switch. { "event" : "MessagesWidgetEditAnswerForm", ] "event" : "MessagesWidgetMessageEdit", "actions" : [ } { "actions" : [ window.location = "https://forum.vodafone.de/t5/Archiv-Internet-Ger%C3%A4te/DS-Lite-auf-Dual-Stack-umstellen/td-p/1682136" + "/page/" + val; "action" : "rerender" Does the service use the crappy DS-Lite solution like Unity Media or are they running a full dual stack? ] "useCountToKudo" : "false", ], "action" : "rerender" }, }); { "context" : "envParam:quiltName", }); { { { { } { }, "action" : "rerender" }, document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "actions" : [ ] }, { var count = 0; "actions" : [ LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "event" : "AcceptSolutionAction", "selector" : "#kudosButtonV2_3", "action" : "rerender" ] { "event" : "RevokeSolutionAction", "action" : "pulsate" "useSimpleView" : "false", { }, "action" : "rerender" { "initiatorDataMatcher" : "data-lia-message-uid" }, } }, { }, ] }, "context" : "", "event" : "ProductMessageEdit", ] watching = false; })(LITHIUM.jQuery); { } LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { "}); { { } "action" : "rerender" { { ] ] { { { "action" : "addClassName" "context" : "envParam:quiltName,message", }, "event" : "MessagesWidgetCommentForm", "componentId" : "forums.widget.message-view", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "eventActions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, ] "actions" : [ "selector" : "#kudosButtonV2_0", }, "disableKudosForAnonUser" : "false", "initiatorDataMatcher" : "data-lia-message-uid" "initiatorBinding" : true, "actions" : [ } }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "action" : "rerender" "actions" : [ function disableInput(pagerId) { "actions" : [ "action" : "rerender" "action" : "rerender" ] LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" } LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, '0iW3o-zMPKGg5D5VTjjwZb2bVnfIqvf9t62KCQ9eOo0. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1edba20426b6d6","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1edba20426b6d6_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/ArchivKIP/thread-id/74551&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"KUrkz25D9XERwdSwvLHeeUWK7KAMND5sRMK4fiv7LO4. "event" : "deleteMessage", { "}); "actions" : [ "event" : "editProductMessage", "initiatorBinding" : true, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useSubjectIcons" : "true", "useSubjectIcons" : "true", }, "context" : "", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { })(LITHIUM.jQuery); }, "parameters" : { "context" : "envParam:quiltName", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" }; "context" : "envParam:quiltName", $(this).next().toggle(); "actions" : [ { }, "}); LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); resetMenu(); }, "useSimpleView" : "false", { "context" : "", "context" : "envParam:entity", { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); }, ] "event" : "MessagesWidgetEditCommentForm", Bist du sicher, dass du fortfahren möchtest? "disableLinks" : "false", ] ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", mit dem Bridge Mode bin ich mir noch nicht ganz im klaren, weil da ja eventuell mein WLan und der Hotspot/Homespot von Vodafone nicht mehr gehen dürfte.... Gute Idee @zoschel. "quiltName" : "ForumMessage", }, "event" : "MessagesWidgetAnswerForm", watching = true; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ ] $(this).toggleClass("view-btn-open view-btn-close"); } { { ] { ] "actions" : [ }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1682363 .lia-rating-control-passive', '#form_9'); { "action" : "addClassName" "}); "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "context" : "envParam:selectedMessage", ] ] } ] "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ ] }, }, }, ] ] "context" : "", }, }, } "action" : "pulsate" "context" : "", ], } }, "action" : "rerender" { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/74551","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HOl0Kv_Z-cj8m8MW3tsI5jnUVtuDQIF1by5sXvApgjA. { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1682363 .lia-rating-control-passive', '#form_9'); "actions" : [ { o.innerHTML = ""; "event" : "removeMessageUserEmailSubscription", "event" : "removeMessageUserEmailSubscription", "}); { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "action" : "rerender" }; "context" : "", "truncateBodyRetainsHtml" : "false", { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "parameters" : { "actions" : [ }, "context" : "envParam:feedbackData", ;(function($) { { "context" : "envParam:quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } "truncateBody" : "true", LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "action" : "rerender" "disableLinks" : "false", "componentId" : "forums.widget.message-view", }, { "context" : "envParam:entity", Bist du sicher, dass du fortfahren möchtest? "event" : "deleteMessage", ], count++; }, "disableLinks" : "false", } ] ] LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); { LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:quiltName", { "quiltName" : "ForumMessage", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } }, "actions" : [ "displayStyle" : "horizontal", "showCountOnly" : "false", } }, }, ], LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); ] }, { ] "initiatorBinding" : true, "action" : "rerender" var o = document.getElementById("custom_board_pagination_warning" + pagerId); }); "event" : "ProductAnswerComment", "context" : "", ] document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "actions" : [ { }, "action" : "rerender" window.location.replace('/t5/user/userloginpage'); "actions" : [ "truncateBody" : "true", "event" : "AcceptSolutionAction", }, ] { "context" : "", "actions" : [ "action" : "rerender" { "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_1edba20426b6d6","tooltipContentSelector":"#link_1edba20426b6d6_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1edba20426b6d6_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); }, { "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", { "}); "componentId" : "kudos.widget.button", "event" : "expandMessage", "revokeMode" : "true", "event" : "MessagesWidgetEditAction", "truncateBodyRetainsHtml" : "false", $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "event" : "addMessageUserEmailSubscription", } { o.innerHTML = ""; } { { { "context" : "", } }, "event" : "RevokeSolutionAction", } "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "event" : "addThreadUserEmailSubscription", var cookieDomain = 'forum.vodafone.de'; { } o.innerHTML = "Page number must be 1 or greater. "action" : "rerender" "context" : "", It's where you go to search for or browse media and make playlists. ] "actions" : [ "event" : "addMessageUserEmailSubscription", }, "action" : "rerender" "actions" : [ "initiatorBinding" : true, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ "event" : "kudoEntity", "event" : "QuickReply", "action" : "rerender" "truncateBody" : "true", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "action" : "rerender" }, "disableLinks" : "false", "actions" : [ "initiatorBinding" : true, "disableKudosForAnonUser" : "false", "actions" : [ }, { Interested whether anyone who's had their old Vodafone Connect router swapped out recently has had one of these as a replacement, and whether it works any better.. New VF router - front New VF router - back. { ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); Bist du sicher, dass du fortfahren möchtest? }, { ] "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "event" : "MessagesWidgetCommentForm", ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1682273,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } "context" : "", "event" : "removeThreadUserEmailSubscription", return false; "event" : "kudoEntity", "action" : "rerender" "initiatorBinding" : true, "event" : "addThreadUserEmailSubscription", } if ( Number(val) > 2 ) // We made it! "actions" : [ "context" : "", } ], } $('#node-menu li.has-sub>a').on('click', function(){ LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); }, { "revokeMode" : "true", }, "event" : "MessagesWidgetEditAnswerForm", "eventActions" : [ } { { "action" : "rerender" "action" : "pulsate" { } "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); ] ] "action" : "rerender" }, "useSimpleView" : "false", { } "action" : "pulsate" } "context" : "envParam:quiltName", "actions" : [ }, ] "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1682247 .lia-rating-control-passive', '#form_4'); "action" : "pulsate" { } { "truncateBody" : "true", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); })(LITHIUM.jQuery); { }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); }); "context" : "envParam:quiltName,message", "event" : "removeThreadUserEmailSubscription", Bist du sicher, dass du fortfahren möchtest? The other issue from the logs when I tried this, was that it is impossible to get UPnP working on the network when the Vodafone modem/router is connected. "context" : "envParam:quiltName", "event" : "markAsSpamWithoutRedirect", "event" : "removeThreadUserEmailSubscription", }, "action" : "rerender" var watching = false; // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" "quiltName" : "ForumMessage", { } { { "context" : "envParam:feedbackData", "actions" : [ "linkDisabled" : "false" "event" : "markAsSpamWithoutRedirect", } { $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); })(LITHIUM.jQuery); // Pull in global jQuery reference "revokeMode" : "true", "event" : "addMessageUserEmailSubscription", "event" : "expandMessage", } { } "actions" : [

Großer Blätterpilz Kreuzworträtsel, Unfall Sellin Heute, Reiseziele Deutschland Junge Leute, Sonderkündigung Dsl Vorlage, Diako Als Arbeitgeber, Essen Bestellen Büdingen, Barfüßer Bier Zum Mitnehmen, Steger Barbarahof Gmbh, Algebra Lehrer Schmidt, Excel Wenn Wert In Zelle Dann,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.